Details of the BTS

General Information of Binding Target of SBP (BTS) (ID: ST00048)
BTS Name	Green fluorescent protein
BTS Type	Protein
Family	GFP family
Gene Name	GFP
Organism	Aequorea victoria (Water jellyfish) (Mesonema victoria)
Function	Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin.
UniProt ID	P42212
UniProt Entry	GFP_AEQVI
PFam	PF01353
Sequence	MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLAD HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
Sequence Length	238

Synthetic Binding Protein (SBP) Targeting This BTS

SBP Name	Highest Status	Mechanism	Affinity	Application	Details	Ref
Affitin anti-GFP D8	Research	Binder	Kd: 2.52 nM	Tools for cellular imaging and protein localization	SBP Info	[1]
Affitin anti-GFP Sso7d\6B9	Research	Binder	Kd: 36.1 nM	Diagnostics and therapeutics for environments with extreme conditions of storage and deployment	SBP Info	[2]
alphaRep protein anti-GFP clone A	Research	Binder	Kd: 1.4 nM	Tools for tracking, modulating or interfering with intracellular processes	SBP Info	[3]
alphaRep protein anti-GFP clone C	Research	Binder	Kd: 4.2 nM	Tools for tracking, modulating or interfering with intracellular processes	SBP Info	[3]
alphaRep protein anti-GFP clone D	Research	Binder	Kd: 14 nM	Tools for tracking, modulating or interfering with intracellular processes	SBP Info	[3]
alphaRep protein anti-GFP clone S6	Research	Binder	Kd: 470 nM	Tools as expression and crystallization helpers	SBP Info	[4]
DARPin anti-GFP 3G124	Research	Binder	Kd: <5 nM	Research tool	SBP Info	[5], [6]
DARPin anti-GFP 3G124nc	Research	Binder	N.A.	Research tool	SBP Info	[7], [8], [6]
DARPin anti-GFP 3G168	Research	Binder	Kd: <5 nM	Research tool	SBP Info	[5]
DARPin anti-GFP 3G61	Research	Binder	Kd: 1.1 nM	Research tool	SBP Info	[7], [5], [6]
DARPin anti-GFP 3G86.1	Research	Binder	Kd: <5 nM	Research tool	SBP Info	[5]
DARPin anti-GFP 3G86.32	Research	Binder	Kd: <5 nM	Research tool	SBP Info	[5], [9], [10]
DARPin anti-GFP B6	Research	Binder	N.A.	Tools for structural analysising of biological targets	SBP Info	[11]
DARPin anti-GFP G10	Research	Binder	N.A.	Tools for structural analysising of biological targets	SBP Info	[11], [12]
Megabody anti-GFP Mb-Nb207-cHopQ	Research	Binder	Kd: 0.077 nM	Research tool	SBP Info	[13]
Megabody anti-GFP Mb-Nb207-cYgKE2	Research	Binder	Kd: 0.087 nM	Research tool	SBP Info	[13]
Monobody anti-GFP GL4	Research	Binder	Kd: 478 nM	Tools for identifying the unanticipated mode of monobody-target interactions	SBP Info	[14]
Monobody anti-GFP GL6	Research	Binder	Kd: 208 nM	Tools for identifying the unanticipated mode of monobody-target interactions	SBP Info	[14]
Monobody anti-GFP GL8	Research	Binder	Kd: 257 nM	Tools for identifying the unanticipated mode of monobody-target interactions	SBP Info	[14]
Monobody anti-GFP GS2	Research	Binder	Kd: 31 nM	Tools for identifying the unanticipated mode of monobody-target interactions	SBP Info	[14], [15]
Monobody anti-GFP GS5	Research	Binder	Kd: 62 nM	Tools for identifying the unanticipated mode of monobody-target interactions	SBP Info	[14], [15]
Nanobody anti-GFP	Research	Binder	Kd: 0.49 nM	Research tool	SBP Info	[16]
Nanobody anti-GFP cAbGFP4	Research	Binder	Kd: 0.32 nM	Research tool	SBP Info	[15]
Nanobody anti-GFP cAbGFP4-0-0-0	Research	Binder	Kd: 0.13 nM	Research tool	SBP Info	[17]
Nanobody anti-GFP cAbGFP4-1-0-0	Research	Binder	Kd: 0.24 nM	Research tool	SBP Info	[17]
Nanobody anti-GFP cAbGFP4-1-0-1	Research	Binder	Kd: 0.6 nM	Research tool	SBP Info	[17]
Nanobody anti-GFP cAbGFP4-1-1-0	Research	Binder	Kd: 0.38 nM	Research tool	SBP Info	[17]
Nanobody anti-GFP cAbGFP4-1-1-1	Research	Binder	Kd: 1.2 nM	Research tool	SBP Info	[17]
Nanobody anti-GFP enhancer	Research	Modulator	Kd: 0.59 nM	Tools for manipulate and study protein conformations	SBP Info	[18]
Nanobody anti-GFP LaG-10	Research	Binder	Kd: 97 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-11	Research	Binder	Kd: 22900 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-12	Research	Binder	Kd: 56 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-14	Research	Binder	Kd: 1.9 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-16	Research	Binder	Kd: 0.7 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-17	Research	Binder	Kd: 50 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-18	Research	Binder	Kd: 3800 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-19	Research	Binder	Kd: 24.6 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-2	Research	Binder	Kd: 19 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-21	Research	Binder	Kd: 7 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-24	Research	Binder	Kd: 41 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-26	Research	Binder	Kd: 2.6 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-27	Research	Binder	Kd: 9.5 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-29	Research	Binder	Kd: 110 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-3	Research	Binder	Kd: 25 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-30	Research	Binder	Kd: 0.5 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-35	Research	Binder	Kd: 23.5 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-37	Research	Binder	Kd: 24 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-41	Research	Binder	Kd: 0.9 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-42	Research	Binder	Kd: 600 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-43	Research	Binder	Kd: 11 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-5	Research	Binder	Kd: 14200 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-6	Research	Binder	Kd: 310 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-8	Research	Binder	Kd: 20000 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG-9	Research	Binder	Kd: 3.5 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP LaG16-G4S-2	Research	Binder	Kd: 0.036 nM	Research tool	SBP Info	[19]
Nanobody anti-GFP minimizer	Research	Modulator	Kd: 0.45 nM	Tools for manipulate and study protein conformations	SBP Info	[18]
Nanobody anti-GFP pcNB1	Research	Binder	Kd: 1 nM	Research tool	SBP Info	[20], [21]
Nanobody anti-GFP pcNB2	Research	Binder	N.A.	Research tool	SBP Info	[20], [21]
Nanobody anti-GFP pcNB3	Research	Binder	N.A.	Research tool	SBP Info	[20], [21]
SWEEPin anti-GFPuv clone 40	Research	Binder	Kd: 24000 nM	Research tool	SBP Info	[22]
SWEEPin anti-GFPuv clone kz02	Research	Binder	Kd: 4600 nM	Research tool	SBP Info	[22]
SWEEPin anti-GFPuv clone kz06	Research	Binder	Kd: 3400 nM	Research tool	SBP Info	[22]
SWEEPin anti-GFPuv clone Kz09	Research	Binder	Kd: 12000 nM	Research tool	SBP Info	[22]

References

1	Use of the Nanofitin Alternative Scaffold as a GFP-Ready Fusion Tag. PLoS One. 2015 Nov 5;10(11):e0142304.
2	Phage display selection of tight specific binding variants from a hyperthermostable Sso7d scaffold protein library.FEBS J. 2016 Apr;283(7):1351-67.
3	Specific GFP-binding artificial proteins (Rep): a new tool for in vitro to live cell applications. Biosci Rep. 2015 Jun 12;35(4):e00223.
4	Alpha repeat proteins (Rep) as expression and crystallization helpers. J Struct Biol. 2018 Feb;201(2):88-99.
5	Protein interference applications in cellular and developmental biology using DARPins that recognize GFP and mCherry. Biol Open. 2014 Nov 21;3(12):1252-61.
6	Design and applications of a clamp for Green Fluorescent Protein with picomolar affinity. Sci Rep. 2017 Nov 24;7(1):16292.
7	DARPins recognizing mTFP1 as novel reagents for in vitro and in vivo protein manipulations. Biol Open. 2018 Oct 29;7(11):bio036749.
8	Tunable light and drug induced depletion of target proteins. Nat Commun. 2020 Jan 16;11(1):304.
9	Fusion of DARPin to Aldolase Enables Visualization of Small Protein by Cryo-EM. Structure. 2019 Jul 2;27(7):1148-1155.e3.
10	Modular protein switches derived from antibody mimetic proteins. Protein Eng Des Sel. 2016 Feb;29(2):77-85.
11	Structural analysis of biological targets by host:guest crystal lattice engineering. Sci Rep. 2019 Oct 23;9(1):15199.
12	Rigid fusions of designed helical repeat binding proteins efficiently protect a binding surface from crystal contacts. Sci Rep. 2019 Nov 7;9(1):16162.
13	Megabodies expand the nanobody toolkit for protein structure determination by single-particle cryo-EM. Nat Methods. 2021 Jan;18(1):60-68.
14	Teaching an old scaffold new tricks: monobodies constructed using alternative surfaces of the FN3 scaffold. J Mol Biol. 2012 Jan 13;415(2):393-405.
15	Broad-Spectrum Proteome Editing with an Engineered Bacterial Ubiquitin Ligase Mimic. ACS Cent Sci. 2019 May 22;5(5):852-866.
16	A Split-Luciferase Reporter Recognizing GFP and mCherry Tags to Facilitate Studies of Protein-Protein Interactions. Int J Mol Sci. 2017 Dec 11;18(12):2681.
17	Disulfide bond introduction for general stabilization of immunoglobulin heavy-chain variable domains. J Mol Biol. 2008 Mar 21;377(2):478-88.
18	Modulation of protein properties in living cells using nanobodies. Nat Struct Mol Biol. 2010 Jan;17(1):133-8.
19	A robust pipeline for rapid production of versatile nanobody repertoires. Nat Methods. 2014 Dec;11(12):1253-60.
20	Resurfaced cell-penetrating nanobodies: A potentially general scaffold for intracellularly targeted protein discovery. Protein Sci. 2016 Jun;25(6):1129-37.
21	Structural and thermodynamic analysis of the GFP:GFP-nanobody complex. Protein Sci. 2010 Dec;19(12):2389-401.
22	A sweet protein monellin as a non-antibody scaffold for synthetic binding proteins. J Biochem. 2021 Jan 2;mvaa147.