Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001413)
SBP Name
DARPin anti-GFP 3G61
Synonyms
DARPin 3G61
Molecular Weight 17.0 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Ribosome display
Highest Status Research
PDB ID 5MAD
Sequence Length 160
SBP Sequence
>DARPin anti-GFP 3G61
GPGSDLGKKLLEAARAGQDDEVRILMANGADVNALDEVGWTPLHLAAWGHLEIVEVLLKN
GADVNAADIDGYTPLHLAAFSGHLEIVEVLLKYGADVNADDQAGFTPLHLAAIFGHLEIV
EVLLKNGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Template Name AR module
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1] , [2] , [3]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Green fluorescent protein
BTS Info
Binder Research tool Kd: 1.1 nM University of Basel; University of Zurich [1] , [2] , [3]
References
1 DARPins recognizing mTFP1 as novel reagents for in vitro and in vivo protein manipulations. Biol Open. 2018 Oct 29;7(11):bio036749.
2 Protein interference applications in cellular and developmental biology using DARPins that recognize GFP and mCherry. Biol Open. 2014 Nov 21;3(12):1252-61.
3 Design and applications of a clamp for Green Fluorescent Protein with picomolar affinity. Sci Rep. 2017 Nov 24;7(1):16292.