General Information of Synthetic Binding Protein (SBP) (ID: SBP003178)
SBP Name
Nanobody anti-GFP LaG-27
Synonyms
Nanobody LaG-27
Molecular Weight 13.3 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display
Highest Status Research
Sequence Length 125
SBP Sequence
>Nanobody anti-GFP LaG-27
MADVQLVESGGGLVQAGGSLRLSCTASGLTISTYNIGWFRQAPGKEREFVGIIIRNGDTT
YYADSVKGRFTISRDNAKNTVYLQMNSVKPADAAVYSCGATVRAGAAAEQYNSYIFRGQG
TQVTV
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Green fluorescent protein
BTS Info
Binder Research tool Kd: 9.5 nM Rockefeller University [1]
References
1 A robust pipeline for rapid production of versatile nanobody repertoires. Nat Methods. 2014 Dec;11(12):1253-60.