General Information of Synthetic Binding Protein (SBP) (ID: SBP000046)
SBP Name
Monobody anti-GFP GL8
Synonyms
Monobody GL8
Molecular Weight 10.3 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Yeast
Selection Method Phage display; Yeast display
Highest Status Research
Sequence Length 94
SBP Sequence
>Monobody anti-GFP GL8
VSSVPTKLEVVAATPTSLLISWDASSSSVSYYRITYGETGGNSPVQEFTVPGSSSTATIS
GLSPGVDYTITVYAYYWYQYSYYQYSPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Template Sequence Description X denotes a mixture of 30% Tyr, 15% Ser, 10% Gly, 5% Phe, 5% Trp and 2.5% each of all the other amino acids except for Cys; B denotes a mixture of Gly, Ser and Tyr; J denotes a mixture of Ser and Tyr.
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Green fluorescent protein
BTS Info
Binder Tools for identifying the unanticipated mode of monobody-target interactions Kd: 257 nM University of Chicago [1]
References
1 Teaching an old scaffold new tricks: monobodies constructed using alternative surfaces of the FN3 scaffold. J Mol Biol. 2012 Jan 13;415(2):393-405.