Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000046) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Monobody anti-GFP GL8
|
|||||
Synonyms |
Monobody GL8
|
|||||
Molecular Weight | 10.3 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Yeast | |||||
Selection Method | Phage display; Yeast display | |||||
Highest Status | Research | |||||
Sequence Length | 94 | |||||
SBP Sequence |
>Monobody anti-GFP GL8
VSSVPTKLEVVAATPTSLLISWDASSSSVSYYRITYGETGGNSPVQEFTVPGSSSTATIS GLSPGVDYTITVYAYYWYQYSYYQYSPISINYRT |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Fibronectin type III domain (FN3) | |||||
Template Sequence Description | X denotes a mixture of 30% Tyr, 15% Ser, 10% Gly, 5% Phe, 5% Trp and 2.5% each of all the other amino acids except for Cys; B denotes a mixture of Gly, Ser and Tyr; J denotes a mixture of Ser and Tyr. | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS047 | [1] | ||||
Scaffold Name | Monobody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Green fluorescent protein | Binder | Tools for identifying the unanticipated mode of monobody-target interactions | Kd: 257 nM | University of Chicago | [1] | |