Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP003358)
SBP Name
Nanobody anti-GFP pcNB3
Synonyms
Nanobody pcNB3
Molecular Weight 14.4 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Highest Status Research
SBP Sequence
>Nanobody anti-GFP pcNB3
MAQVQLVEKGGGKVRAGGKLRLRCTASGGSEYSYSTFSLGWFRQAPGQEREAVAAIASMG
GLTYYADSVKGRFKIKRDNAKNTVTLRMNNLKPEDTAIYYCAAVRGYFMRLPSSHNFRYW
GQGTRVTVSR
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name NB3
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1] , [2]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Green fluorescent protein
BTS Info
Binder Research tool N.A. Colorado State University [1] , [2]
References
1 Resurfaced cell-penetrating nanobodies: A potentially general scaffold for intracellularly targeted protein discovery. Protein Sci. 2016 Jun;25(6):1129-37.
2 Structural and thermodynamic analysis of the GFP:GFP-nanobody complex. Protein Sci. 2010 Dec;19(12):2389-401.