Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003327) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Nanobody anti-GFP cAbGFP4-1-0-1
|
|||||
Synonyms |
Nanobody cAbGFP4-1-0-1
|
|||||
Molecular Weight | 12.7 kDa | |||||
Thermal Denaturation TEMP | 75.7 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Highest Status | Research | |||||
SBP Sequence |
>Nanobody anti-GFP SAbGFP4-1-0-1
QVQLVESGGALVQPGGSLRLSSAASGFPVNRYSMRWYRQAPGKEREWVSGMSSAGDRSSY EDSVKGRFTSSRDDARNTVYLQMNSLKPEDTAVYYSNVNVGFEYWGQGTQVTVSS |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | cAbPSA-N8 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS048 | [1] | ||||
Scaffold Name | Nanobody | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Green fluorescent protein | Binder | Research tool | Kd: 0.6 nM | Vrije Universiteit Brussel | [1] | |