Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001051) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Nanobody anti-GFP enhancer
|
|||||
| Synonyms |
GFP-specific nanobody Enhancer
|
|||||
| Molecular Weight | 13.7 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Research | |||||
| PDB ID | 3K1K | |||||
| Sequence Length | 123 | |||||
| SBP Sequence |
>Nanobody anti-GFP enhancer
MAQVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRS SYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVSSHHH HHH |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS048 | [1] | ||||
| Scaffold Name | Nanobody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Green fluorescent protein | Modulator | Tools for manipulate and study protein conformations | Kd: 0.59 nM | Ludwig-Maximilians University Munich | [1] | |