General Information of Synthetic Binding Protein (SBP) (ID: SBP000654)
SBP Name
Affitin anti-GFP Sso7d\6B9
Synonyms
Affitin Sso7d\GFP\6B9
Molecular Weight 7.3 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Selection Method Phage display
Highest Status Research
Sequence Length 64
SBP Sequence
>Affitin anti-GFP Sso7d\6B9
MATVKFKYKGEEKEVDISKIWAVIRDGKDIYFSYDLGGGKAGLGRVSEKDAPKELLQMLE
KQKK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Sso7d
Protein Scaffold Information of This SBP
Scaffold ID PS007
Scaffold Info
[1]
Scaffold Name Affitin
Scaffold Class Non-Antibody
Fold Type One Alpha-Helix + Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Green fluorescent protein
BTS Info
Binder Diagnostics and therapeutics for environments with extreme conditions of storage and deployment Kd: 36.1 nM Colorado State University [1]
References
1 Phage display selection of tight specific binding variants from a hyperthermostable Sso7d scaffold protein library.FEBS J. 2016 Apr;283(7):1351-67.