Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001457)
SBP Name
DARPin anti-GFP 3G168
Synonyms
DARPin 3G168
Molecular Weight 17.0 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli XL1-Blue
Selection Method Ribosome display
Highest Status Research
Sequence Length 159
SBP Sequence
>DARPin anti-GFP 3G168
GSDLGKKLLEAARAGQDDEVRILMANGADVNALDRFGLTPLHLAAQRGHLEIVEVLLKCG
ADVNAADLWGQTPLHLAATAGHLEIVEVLLKNGADVNARDNIGHTPLHLAAWAGHLEIVE
VLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name AR module
Template Sequence Description X represents a randomized position to all amino acids except C and P; Z represents a randomized position to only N, H or Y.
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Superfolder green fluorescent protein
BTS Info
Binder Research tool Kd: 16 nM University of Basel [1]
Green fluorescent protein
BTS Info
Binder Research tool Kd: <5 nM University of Basel [1]
References
1 Protein interference applications in cellular and developmental biology using DARPins that recognize GFP and mCherry. Biol Open. 2014 Nov 21;3(12):1252-61.