Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001457) | ||||||
---|---|---|---|---|---|---|
SBP Name |
DARPin anti-GFP 3G168
|
|||||
Synonyms |
DARPin 3G168
|
|||||
Molecular Weight | 17.0 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli XL1-Blue | |||||
Selection Method | Ribosome display | |||||
Highest Status | Research | |||||
Sequence Length | 159 | |||||
SBP Sequence |
>DARPin anti-GFP 3G168
GSDLGKKLLEAARAGQDDEVRILMANGADVNALDRFGLTPLHLAAQRGHLEIVEVLLKCG ADVNAADLWGQTPLHLAATAGHLEIVEVLLKNGADVNARDNIGHTPLHLAAWAGHLEIVE VLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | AR module | |||||
Template Sequence Description | X represents a randomized position to all amino acids except C and P; Z represents a randomized position to only N, H or Y. | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS027 | [1] | ||||
Scaffold Name | DARPin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Alpha-Helices + Loops | |||||