Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000661) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
alphaRep protein anti-GFP clone C
|
|||||
| Synonyms |
alphaRep protein bGFP-C
|
|||||
| Molecular Weight | 17.6 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| PDB ID | 4XVP | |||||
| Sequence Length | 160 | |||||
| SBP Sequence |
>alphaRep protein anti-GFP clone C
TDPEKVEMYIKNLQDDSMRVRYNAATALGKIGDERAVEPLIKALKDEDGYVRLEAAEALG EIGDERAVEPLIKALKDEDPDVRSEAALALGKIGDERAVEPLIKALKDEDRYVRMAAAWA LGKIGGERVRAAMEKLAETGTGFARKVAVNYLETHKSLIS |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS009 | [1] | ||||
| Scaffold Name | Alpha-Rep protein | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Green fluorescent protein | Binder | Tools for tracking, modulating or interfering with intracellular processes | Kd: 4.2 nM | Institute for Integrative Biology of the Cell (I2BC) | [1] | |