Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000663) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
alphaRep protein anti-GFP clone S6
|
|||||
| Synonyms |
alphaRep protein bGFP-S6
|
|||||
| Molecular Weight | 20.5 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Research | |||||
| Sequence Length | 191 | |||||
| SBP Sequence |
>alphaRep protein anti-GFP clone S6
TDPEKVEMYIKNLQDDSGYVRSRAAEALGKIGDERAVEPLIKALKDEDPDVRKAAADALG KIGDERAVEPLIKALKDEDANVRISAAQALGKIGDERAVEPLIKALKDEDPYVRIEAALA LGKIGDERAVEPLIKALKDEDKAVRISAAAALGEIGGERVRAAMEKLAETGTGFARKVAV NYLETHKSLIS |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | bGFP-D | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS009 | [1] | ||||
| Scaffold Name | Alpha-Rep protein | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Green fluorescent protein | Binder | Tools as expression and crystallization helpers | Kd: 470 nM | Institute for Integrative Biology of the Cell (I2BC) | [1] | |