Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003356) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Nanobody anti-GFP pcNB1
|
|||||
| Synonyms |
Nanobody pcNB1
|
|||||
| Molecular Weight | 13.4 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Highest Status | Research | |||||
| SBP Sequence |
>Nanobody anti-GFP pcNB1
MQVQLVEKGGKRVQPGGSLRLKCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSS YEDSVKGRFKIKRDDARNTVYLRMRKLKPEDTAVYYCNVNVGFEYWGQGTRVTVSKK |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | NB1 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS048 | [1] , [2] | ||||
| Scaffold Name | Nanobody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||