Details of the BTS

General Information of Binding Target of SBP (BTS) (ID: ST00045)
BTS Name	Epithelial cell adhesion molecule
Synonyms	Ep-CAM; Adenocarcinoma-associated antigen; Cell surface glycoprotein Trop-1; Epithelial cell surface antigen; Epithelial glycoprotein; EGP; Epithelial glycoprotein 314; EGP314; hEGP314; KS 1/4 antigen; KSA; Major gastrointestinal tumor-associated protein GA733-2; Tumor-associated calcium signal transducer 1; CD antigen CD326
BTS Type	Protein
Family	EPCAM family
Gene Name	EPCAM
Organism	Homo sapiens (Human)
Function	May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
UniProt ID	P16422
UniProt Entry	EPCAM_HUMAN
PFam	PF18635 ; PF00086
Gene ID	4072
Sequence	MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICS KLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVN TAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKF ITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQL DLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKA EIKEMGEMHRELNA
Sequence Length	314

Synthetic Binding Protein (SBP) Targeting This BTS

SBP Name	Highest Status	Mechanism	Affinity	Application	Details	Ref
Affitin anti-EpCAM A2	Research	Binder	Kd: 0.16 nM	Research tool	SBP Info	[1]
Affitin anti-EpCAM B10	Research	Binder	Kd: 0.3 nM	Research tool	SBP Info	[1]
Affitin anti-EpCAM C7	Research	Binder	Kd: 0.11 nM	Research tool	SBP Info	[1]
BiTE anti-EpCAM/CD3 MuS110	Research	Binder	N.A.	Breast cancer [ICD-11: 2C6Z]; Lung cancer [ICD-11: 2C25.Z]	SBP Info	[2], [3]
BiTE Solitomab	Phase II	Inhibitor	Kd: 16 nM	Lung cancer [ICD-11: 2C25.Z]; Gastrointestinal cancer [ICD-11: 2C11.Z]	SBP Info	[2], [4]
DARPin anti-EpCAM Ac1	Research	Binder	Kd: 48 nM	Measles virus infection [ICD-11: XN82V]	SBP Info	[5], [6], [7]
DARPin anti-EpCAM Ac2	Research	Binder	Kd: 130 nM	Measles virus infection [ICD-11: XN82V]; Ovarian cancer [ICD-11: 2C73.Z]	SBP Info	[5], [6], [7]
DARPin anti-EpCAM Ec1	Research	Binder	Kd: 0.068 nM	Ovarian cancer [ICD-11: 2C73.Z]	SBP Info	[8], [9]
DARPin anti-EpCAM Ec2	Research	Binder	Kd: 1.1 nM	Measles virus infection [ICD-11: XN82V]	SBP Info	[5], [6], [7]
DARPin anti-EpCAM Ec3	Research	Binder	Kd: 1.3 nM	Measles virus infection [ICD-11: XN82V]	SBP Info	[5], [6], [7]
DARPin anti-EpCAM Ec4	Research	Binder	Kd: 1.7 nM	Measles virus infection [ICD-11: XN82V]	SBP Info	[5], [6], [7]
DARPin anti-EpCAM Ec5	Research	Binder	Kd: 0.18 nM	Measles virus infection [ICD-11: XN82V]	SBP Info	[5], [6], [7]
Fab Citatuzumab	Phase I	Binder	N.A.	Solid tumour/cancer [ICD-11: 2A00-2F9Z]	SBP Info	[10]
Macrocyclic peptide anti-EpCAM Epi-1	Research	Binder	Kd: 1.7 nM	Tools as fluorescent imaging probe	SBP Info	[11]
Macrocyclic peptide anti-EpCAM Epi-3	Research	Binder	Kd: 1.6 nM	Tools as fluorescent imaging probe	SBP Info	[11]
scFv Oportuzumab	Preregistration	Binder	N.A.	Bladder cancer [ICD-11: 2C94.Z]; Head and neck cancer	SBP Info	[12]
VNAR anti-EpCAM 1013	Research	Binder	Kd: 7 nM	Research tool	SBP Info	[13]
VNAR anti-EpCAM 1014	Research	Binder	Kd: 5 nM	Research tool	SBP Info	[13]
VNAR anti-EpCAM 1017	Research	Binder	Kd: 6 nM	Research tool	SBP Info	[13]
VNAR anti-EpCAM A2	Research	Binder	Kd: 349 nM	Research tool	SBP Info	[14]
VNAR anti-EpCAM clone 5005	Research	Binder	Kd: 40 nM	Research tool	SBP Info	[15], [13], [16]
VNAR anti-EpCAM clone SH2	Research	Binder	N.A.	Research tool	SBP Info	[16]
VNAR anti-EpCAM H3	Research	Binder	Kd: 1301 nM	Research tool	SBP Info	[13], [16]
VNAR anti-EpCAM H5	Research	Binder	Kd: 1030 nM	Research tool	SBP Info	[13], [16]
VNAR anti-EpCAM R23	Research	Binder	Kd: 24 nM	Research tool	SBP Info	[13]
VNAR anti-EpCAM/CD3E B1	Research	Binder	Kd: 46 nM	Research tool	SBP Info	[15]
VNAR anti-EpCAM/Fc-gamma F1	Research	Binder	Kd: 53 nM	Research tool	SBP Info	[15]

References

1	A novel, smaller scaffold for Affitins: Showcase with binders specific for EpCAM. Biotechnol Bioeng. 2018 Feb;115(2):290-299.
2	Recent advances in the development of novel protein scaffolds based therapeutics. Int J Biol Macromol. 2017 Sep;102:630-641.
3	Therapeutic window of MuS110, a single-chain antibody construct bispecific for murine EpCAM and murine CD3. Cancer Res. 2008 Jan 1;68(1):143-51.
4	MT110: a novel bispecific single-chain antibody construct with high efficacy in eradicating established tumors. Mol Immunol. 2006 Mar;43(8):1129-43.
5	Enhanced lysis by bispecific oncolytic measles viruses simultaneously using HER2/neu or EpCAM as target receptors. Mol Ther Oncolytics. 2016 Feb 24;3:16003.
6	DARPin-targeting of measles virus: unique bispecificity, effective oncolysis, and enhanced safety. Mol Ther. 2013 Apr;21(4):849-59.
7	DARPins recognizing the tumor-associated antigen EpCAM selected by phage and ribosome display and engineered for multivalency. J Mol Biol. 2011 Nov 4;413(4):826-43.
8	EpCAM-Binding DARPins for Targeted Photodynamic Therapy of Ovarian Cancer. Cancers (Basel). 2020 Jul 2;12(7):1762.
9	Radionuclide Molecular Imaging of EpCAM Expression in Triple-Negative Breast Cancer Using the Scaffold Protein DARPin Ec1. Molecules. 2020 Oct 14;25(20):4719.
10	Phase I Trial: Cirmtuzumab Inhibits ROR1 Signaling and Stemness Signatures in Patients with Chronic Lymphocytic Leukemia. Cell Stem Cell. 2018 Jun 1;22(6):951-959.e3.
11	A Fluorescent Imaging Probe Based on a Macrocyclic Scaffold That Binds to Cellular EpCAM. J Mol Evol. 2015 Dec;81(5-6):210-7.
12	Antibodies to watch in 2020. MAbs. Jan-Dec 2020;12(1):1703531.
13	Shark Attack: high affinity binding proteins derived from shark vNAR domains by stepwise in vitro affinity maturation. J Biotechnol. 2014 Dec 10;191:236-45.
14	Isolation of a pH-Sensitive IgNAR Variable Domain from a Yeast-Displayed, Histidine-Doped Master Library. Mar Biotechnol (NY). 2016 Apr;18(2):161-7.
15	The Shark Strikes Twice: Hypervariable Loop 2 of Shark IgNAR Antibody Variable Domains and Its Potential to Function as an Autonomous Paratope. Mar Biotechnol (NY). 2015 Aug;17(4):386-92.
16	A simplified procedure for antibody engineering by yeast surface display: Coupling display levels and target binding by ribosomal skipping. Biotechnol J. 2017 Feb;12(2).