General Information of Synthetic Binding Protein (SBP) (ID: SBP000626)
SBP Name
Affitin anti-EpCAM B10
Synonyms
Affitin B10
Molecular Weight 8.3 kDa
Thermal Denaturation TEMP 69.3 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli DH5 (alpha) Iq
Selection Method Ribosome display
Highest Status Research
Sequence Length 62
SBP Sequence
>Affitin anti-EpCAM B10
GSATKVKFKFVGEEKEVDISKISHVRRVGKMIAFHYDDNGKEGPGIVSEKDAPKELLEKL
KL
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Aho7c WT
Protein Scaffold Information of This SBP
Scaffold ID PS007
Scaffold Info
[1]
Scaffold Name Affitin
Scaffold Class Non-Antibody
Fold Type One Alpha-Helix + Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Epithelial cell adhesion molecule
BTS Info
Binder Research tool Kd: 0.3 nM Angel University; Nantes University [1]
References
1 A novel, smaller scaffold for Affitins: Showcase with binders specific for EpCAM. Biotechnol Bioeng. 2018 Feb;115(2):290-299.