Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003372) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Fab Citatuzumab
|
|||||
| Synonyms |
VB6-845; VB6-845d
|
|||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Phase I | |||||
| SBP Sequence |
>VH Chain
EVQLVQSGPGLVQPGGSVRISCAASGYTFTNYGMNWVKQAPGKGLEWMGWINTYTGESTY ADSFKGRFTFSLDTSASAAYLQINSLRAEDTAVYYCARFAIKGDYWGQGTLLTVSS >VL Chain DIQMTQSPSSLSASVGDRVTITCRSTKSLLHSNGITYLYWYQQKPGKAPKLLIYQMSNL ASGVPSRFSSSGSGTDFTLTISSLQPEDFATYYCAQNLEIPRTFGQGTKVELK |
|||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS034 | [1] | ||||
| Scaffold Name | Fab | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Epithelial cell adhesion molecule | Binder | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | N.A. | University of California; Viventia Biotech; Sesen Bio | [1] | |
| Clinical Trial Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| NCT00481936 | Click to show the Detail | |||||
| Indication | Advanced Solid Tumours of Epithelial Origin | |||||
| Phase | Phase I | |||||
| Title | A Phase I, Escalating Dose Study of VB6-845, a Recombinant Fusion Protein Targeting EpCAM, in Patients With Advanced Solid Tumours of Epithelial Origin | |||||
| Status | Terminated | |||||
| Sponsor | Viventia Bio | |||||