Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003383) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
scFv Oportuzumab
|
|||||
| Synonyms |
VB-4847; VB-845; VB4-845
|
|||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Preregistration | |||||
| SBP Sequence |
>VH Chain
EVQLVQSGPGLVQPGGSVRISCAASGYTFTNYGMNWVKQAPGKGLEWMGWINTYTGESTY ADSFKGRFTFSLDTSASAAYLQINSLRAEDTAVYYCARFAIKGDYWGQGTLLTVSS >VL Chain DIQMTQSPSSLSASVGDRVTITCRSTKSLLHSNGITYLYWYQQKPGKAPKLLIYQMSNLA SGVPSRFSSSGSGTDFTLTISSLQPEDFATYYCAQNLEIPRTFGQGTKVELK |
|||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS057 | [1] | ||||
| Scaffold Name | scFv | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Epithelial cell adhesion molecule | Binder | Bladder cancer [ICD-11: 2C94.Z]; Head and neck cancer | N.A. | Sesen Bio | [1] | |
| Clinical Trial Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| NCT03258593 | Click to show the Detail | |||||
| Indication | High-Grade Non-Muscle-Invasive Bladder Cancer | |||||
| Phase | Phase I | |||||
| Title | A Phase I Single-Arm Study of the Combination of Durvalumab (MEDI4736) and Vicineum (Oportuzumab Monatox, VB4-845) in Subjects With High-Grade Non-Muscle-Invasive Bladder Cancer Previously Treated With Bacillus Calmette-Gu(SqrRoot)(Copyright)Rin (BCG) | |||||
| Status | Recruiting | |||||
| Sponsor | National Cancer Institute (NCI) | |||||
| NCT04859751 | Click to show the Detail | |||||
| Indication | Non-Muscle Invasive Bladder Cancer | |||||
| Phase | Phase III | |||||
| Title | Study of VB4-845 Injection for Treating Patients With Non-muscle Invasive Bladder Cancer | |||||
| Status | Unknown status | |||||
| Sponsor | Qilu Pharmaceutical Co., Ltd. | |||||