General Information of Synthetic Binding Protein (SBP) (ID: SBP000691)
SBP Name
VNAR anti-EpCAM 1014
Synonyms
VNAR 1014
Molecular Weight 11.9 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli MBH 71-18
Selection Method Yeast display
Highest Status Research
Sequence Length 110
SBP Sequence
>VNAR anti-EpCAM 1014
MAARLEQTPTTTTKEAGESLTINCVLKAPVSYLGSTYWYFTKKGATTRASLSTGGRYSDT
KNTASKSFSLRISDLRVEDSGTYHCEADMLFSNKLSMEGIEGGGTTVTVK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name vNAR H3
Protein Scaffold Information of This SBP
Scaffold ID PS065
Scaffold Info
[1]
Scaffold Name vNAR
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Epithelial cell adhesion molecule
BTS Info
Binder Research tool Kd: 5 nM Technical University of Darmstadt [1]
References
1 Shark Attack: high affinity binding proteins derived from shark vNAR domains by stepwise in vitro affinity maturation. J Biotechnol. 2014 Dec 10;191:236-45.