Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000691) | ||||||
---|---|---|---|---|---|---|
SBP Name |
VNAR anti-EpCAM 1014
|
|||||
Synonyms |
VNAR 1014
|
|||||
Molecular Weight | 11.9 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli MBH 71-18 | |||||
Selection Method | Yeast display | |||||
Highest Status | Research | |||||
Sequence Length | 110 | |||||
SBP Sequence |
>VNAR anti-EpCAM 1014
MAARLEQTPTTTTKEAGESLTINCVLKAPVSYLGSTYWYFTKKGATTRASLSTGGRYSDT KNTASKSFSLRISDLRVEDSGTYHCEADMLFSNKLSMEGIEGGGTTVTVK |
|||||
3D Structure |
|
|||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | vNAR H3 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS065 | [1] | ||||
Scaffold Name | vNAR | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Epithelial cell adhesion molecule | Binder | Research tool | Kd: 5 nM | Technical University of Darmstadt | [1] | |