Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP003047)
SBP Name
DARPin anti-EpCAM Ac2
Synonyms
DARPin Ac2
Molecular Weight 17.2 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Ribosome display
Highest Status Research
Sequence Length 160
SBP Sequence
>DARPin anti-EpCAM Ac2
DLGKKLLEAARAGQDDEVRILMANGADVNAKDEYGSTPLHLAATLGHLEIVEVLLKHGAD
VNADDATGLTPLHLAAWNGHLEIVEVLLKYGADVNAMDFEGWTPLHLAAHFGHLEIVEVL
LKYGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAAKLN
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name N3C
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1] , [2] , [3]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Epithelial cell adhesion molecule
BTS Info
Binder Measles virus infection [ICD-11: XN82V]; Ovarian cancer [ICD-11: 2C73.Z] Kd: 130 nM Paul-Ehrlich-Institut; University of Zurich [1] , [2] , [3]
References
1 Enhanced lysis by bispecific oncolytic measles viruses simultaneously using HER2/neu or EpCAM as target receptors. Mol Ther Oncolytics. 2016 Feb 24;3:16003.
2 DARPin-targeting of measles virus: unique bispecificity, effective oncolysis, and enhanced safety. Mol Ther. 2013 Apr;21(4):849-59.
3 DARPins recognizing the tumor-associated antigen EpCAM selected by phage and ribosome display and engineered for multivalency. J Mol Biol. 2011 Nov 4;413(4):826-43.