General Information of Synthetic Binding Protein (SBP) (ID: SBP000694)
SBP Name
VNAR anti-EpCAM H3
Synonyms
VNAR H3
Molecular Weight 12.0 kDa
Thermal Denaturation TEMP 75.1 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli MBH 71-18
Selection Method Yeast display
Highest Status Research
Sequence Length 110
SBP Sequence
>VNAR anti-EpCAM H3
MAARLEQTPTTTTKEAGESLTINCVLKGSGYVLGRTYWYFTKKGATKKASLSTGGRYSDT
KNTASKSFSLRISDLRVEDSGTYHCEALIYSDMGMIMWKIEGGGTVLTVN
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS065
Scaffold Info
[1] , [2]
Scaffold Name vNAR
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Epithelial cell adhesion molecule
BTS Info
Binder Research tool Kd: 1301 nM Technical University of Darmstadt [1] , [2]
References
1 Shark Attack: high affinity binding proteins derived from shark vNAR domains by stepwise in vitro affinity maturation. J Biotechnol. 2014 Dec 10;191:236-45.
2 A simplified procedure for antibody engineering by yeast surface display: Coupling display levels and target binding by ribosomal skipping. Biotechnol J. 2017 Feb;12(2).