Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000689)
SBP Name
VNAR anti-EpCAM clone 5005
Synonyms
VNAR 5005; SH1/5005
Molecular Weight 12.2 kDa
Thermal Denaturation TEMP 64.9 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli MBH 71-18
Selection Method Yeast display
Highest Status Research
Sequence Length 110
SBP Sequence
>VNAR anti-EpCAM clone 5005
MAARLEQTPTTTTKEAGESLTINCVLKPEWTILGRTYWYFTKKGATKKARLSTGGRYSDT
KNTASKSLSLRISDLRVEDSGTYHCEALIYSDMGMIMWKIEGGGTTVTVK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name vNAR H3
Protein Scaffold Information of This SBP
Scaffold ID PS065
Scaffold Info
[1] , [2] , [3]
Scaffold Name vNAR
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Epithelial cell adhesion molecule
BTS Info
Binder Research tool Kd: 40 nM Technical University of Darmstadt [1] , [2] , [3]
References
1 The Shark Strikes Twice: Hypervariable Loop 2 of Shark IgNAR Antibody Variable Domains and Its Potential to Function as an Autonomous Paratope. Mar Biotechnol (NY). 2015 Aug;17(4):386-92.
2 Shark Attack: high affinity binding proteins derived from shark vNAR domains by stepwise in vitro affinity maturation. J Biotechnol. 2014 Dec 10;191:236-45.
3 A simplified procedure for antibody engineering by yeast surface display: Coupling display levels and target binding by ribosomal skipping. Biotechnol J. 2017 Feb;12(2).