Details of the BTS

General Information of Binding Target of SBP (BTS) (ID: ST00130)
BTS Name	Maltose/maltodextrin-binding periplasmic protein
Synonyms	MMBP; Maltodextrin-binding protein; Maltose-binding protein; MBP
BTS Type	Protein
Family	Bacterial solute-binding protein 1 family
Gene Name	malE
Organism	Escherichia coli (strain K12)
Function	Part of the ABC transporter complex MalEFGK involved in maltose/maltodextrin import. Binds maltose and higher maltodextrins such as maltotriose.
UniProt ID	P0AEX9
UniProt Entry	MALE_ECOLI
PFam	PF01547
Gene ID	61753691;948538
Sequence	MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIK VTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTW DAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEP YFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAE AAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKE LAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIP QMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK
Sequence Length	396

Synthetic Binding Protein (SBP) Targeting This BTS

SBP Name	Highest Status	Mechanism	Affinity	Application	Details	Ref
DARPin anti-MBP clone 16	Research	Binder	N.A.	Tools for facilitating the crystallization of an MBP fusion protein.	SBP Info	[1]
DARPin anti-MBP off7	Research	Inhibitor	Kd: 4.4 nM	Research tool	SBP Info	[1], [2], [3]
DARPin anti-MBP off7-M1	Research	binder	Kd: 65 nM	Tools for purificating of MBP fusion proteins	SBP Info	[4]
DARPin anti-MBP off7-M2	Research	binder	Kd: 114 nM	Tools for purificating of MBP fusion proteins	SBP Info	[4]
DARPin anti-MBP off7-M3	Research	binder	Kd: 41 nM	Tools for purificating of MBP fusion proteins	SBP Info	[4]
Diabody anti-MBP 4922	Research	Binder	N.A.	Tools for analyzing cryo-electron microscopic images and building protein nano-assemblies	SBP Info	[5]
Diabody anti-MBP 6683	Research	Binder	N.A.	Tools for analyzing cryo-electron microscopic images and building protein nano-assemblies	SBP Info	[5]
Monobody anti-MBP clone 74	Research	Binder	Kd: 81 nM	Research tool	SBP Info	[6]
Monobody anti-MBP clone 76	Research	Binder	Kd: 30 nM	Research tool	SBP Info	[6]
Monobody anti-MBP clone 79	Research	Binder	Kd: 89 nM	Research tool	SBP Info	[6]
Monobody anti-MBP YS1	Research	Binder	Kd: 81 nM	Research tool	SBP Info	[7]
Monobody anti-MBP YSX1	Research	Binder	Kd: 5.7 nM	Research tool	SBP Info	[7]
Monobody anti-MBP YSX2	Research	Binder	Kd: 23 nM	Research tool	SBP Info	[7]
Monobody anti-MBP YSX3	Research	Binder	Kd: 62 nM	Research tool	SBP Info	[7]
Nanobody anti-MBP clone 1	Research	Binder	Kd: 24.1 nM	Tools for the conformational trapping of membrane proteins	SBP Info	[8]
Nanobody anti-MBP clone 2	Research	Binder	Kd: 40.4 nM	Tools for the conformational trapping of membrane proteins	SBP Info	[8]
Nanobody anti-MBP clone 3	Research	Binder	Kd: 502 nM	Tools for the conformational trapping of membrane proteins	SBP Info	[8]
VL dAb anti-MBP VL(SS)-1	Research	Binder	Kd: 900 nM	Tools as soluble and highly thermostable binders	SBP Info	[9]
VL dAb anti-MBP VL(SS)-2	Research	Binder	Kd: 2500 nM	Tools as soluble and highly thermostable binders	SBP Info	[9]
VL dAb anti-MBP VL(SS)-3	Research	Binder	Kd: 7100 nM	Tools as soluble and highly thermostable binders	SBP Info	[9]
VL dAb anti-MBP VL-1	Research	Binder	Kd: 1300 nM	Tools as soluble and highly thermostable binders	SBP Info	[9]
VL dAb anti-MBP VL-2	Research	Binder	Kd: 3200 nM	Tools as soluble and highly thermostable binders	SBP Info	[9]
VL dAb anti-MBP VL-3	Research	Binder	Kd: 1500 nM	Tools as soluble and highly thermostable binders	SBP Info	[9]
VL dAb anti-MBP VL-4	Research	Binder	Kd: 1200 nM	Tools as soluble and highly thermostable binders	SBP Info	[9]

References

1	MBP-binding DARPins facilitate the crystallization of an MBP fusion protein. Acta Crystallogr F Struct Biol Commun. 2018 Sep 1;74(Pt 9):549-557.
2	Modular protein switches derived from antibody mimetic proteins. Protein Eng Des Sel. 2016 Feb;29(2):77-85.
3	Bioengineering of bacteria to assemble custom-made polyester affinity resins. Appl Environ Microbiol. 2015 Jan;81(1):282-91.
4	Purification of MBP fusion proteins using engineered DARPin affinity matrix. Int J Biol Macromol. 2021 Sep 30;187:105-112.
5	Crystal structures of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface. Sci Rep. 2016 Sep 29;6:34515.
6	High-affinity single-domain binding proteins with a binary-code interface. Proc Natl Acad Sci U S A. 2007 Apr 17;104(16):6632-7.
7	A dominant conformational role for amino acid diversity in minimalist protein-protein interfaces. J Mol Biol. 2008 Aug 29;381(2):407-18.
8	Synthetic single domain antibodies for the conformational trapping of membrane proteins. Elife. 2018 May 24;7:e34317.
9	A disulfide-stabilized human V L single-domain antibody library is a source of soluble and highly thermostable binders. Mol Immunol. 2017 Oct;90:190-196.