Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001024) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Diabody anti-MBP 4922
|
|||||
| Synonyms |
Diabody 4922
|
|||||
| Molecular Weight | 21.5 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | High Five insect cells | |||||
| Highest Status | Research | |||||
| Sequence Length | 203 | |||||
| SBP Sequence |
>Diabody anti-MBP 4922
EVQLVESGGGLVQPGGSLRLSCAASGFTFRNSAMHWVRQAPGKGLEWVSSIWYSGSNTYY ADSVKGRFTISRDNSKNTLYLQMNSLIAEDTAVYYCARFAGGWGAYDVWGQGTLVTVSSG GGGSDIVLTQSPATLSLSPGERATLSCRASQSVSSNYLAWYQQKPGQAPRLLIYDSSSRA TGVPARFSGSGSGTDFTLTISSL |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Diabody (PDBID 1LMK) | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS031 | [1] | ||||
| Scaffold Name | Diabody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Maltose/maltodextrin-binding periplasmic protein | Binder | Tools for analyzing cryo-electron microscopic images and building protein nano-assemblies | N.A. | Graduate School of Nanoscience and Technology | [1] | |