Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000989)
SBP Name
VL dAb anti-MBP VL(SS)-2
Synonyms
VL(SS)-2
Molecular Weight 11.6 kDa
Thermal Denaturation TEMP 70 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli TG1
Selection Method Phage display
Highest Status Research
Sequence Length 107
SBP Sequence
>VL dAb anti-MBP VL(SS)-2
DIQMTQSPSSLSASVGDRVTITCMASQSIVKNLKWYQQKPGKAPKLLCFAASILTSGVPS
RFSCSGSGTDFTLTISNLQPEDFATYYCQQSYSTPRTFGHGTKVTVL
Sequence Description Cys I and Cys IV form a bridge; Cys II and Cys III form a bridge.
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name HVLP324(SS)
Template Sequence Description Cys I and Cys IV form a bridge; Cys II and Cys III form a bridge.
Protein Scaffold Information of This SBP
Scaffold ID PS064
Scaffold Info
[1]
Scaffold Name VL dAb
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Maltose/maltodextrin-binding periplasmic protein
BTS Info
Binder Tools as soluble and highly thermostable binders Kd: 2500 nM National Research Council of Canada [1]
References
1 A disulfide-stabilized human V L single-domain antibody library is a source of soluble and highly thermostable binders. Mol Immunol. 2017 Oct;90:190-196.