General Information of Synthetic Binding Protein (SBP) (ID: SBP000985)
SBP Name
VL dAb anti-MBP VL-2
Synonyms
VL-2
Molecular Weight 11.7 kDa
Thermal Denaturation TEMP 60.7 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli TG1
Selection Method Phage display
Highest Status Research
Sequence Length 107
SBP Sequence
>VL dAb anti-MBP VL-2
DIQMTQSPSSLSASVGDRVTITCRASQSIARNLIWYQQKPGKAPKLLIFAASYRYSGVPS
RFSGSGSGTDFTLTISNLQPEDFATYYCQQSYSTPRTFGHGTKVTVL
Sequence Description Cys I and Cys II form a bridge.
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name HVLP324
Template Sequence Description Cys I and Cys II form a bridge.
Protein Scaffold Information of This SBP
Scaffold ID PS064
Scaffold Info
[1]
Scaffold Name VL dAb
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Maltose/maltodextrin-binding periplasmic protein
BTS Info
Binder Tools as soluble and highly thermostable binders Kd: 3200 nM National Research Council of Canada [1]
References
1 A disulfide-stabilized human V L single-domain antibody library is a source of soluble and highly thermostable binders. Mol Immunol. 2017 Oct;90:190-196.