Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001410)
SBP Name
DARPin anti-MBP off7
Synonyms
DARPin off7
Molecular Weight 17.0 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21-CodonPlus (DE3)-RIL
Highest Status Research
PDB ID 1SVX
Sequence Length 159
SBP Sequence
>DARPin anti-MBP off7
GSDLGRKLLEAARAGQDDEVRILMANGADVNAADNTGTTPLHLAAYSGHLEIVEVLLKHG
ADVDASDVFGYTPLHLAAYWGHLEIVEVLLKNGADVNAMDSDGMTPLHLAAKWGYLEIVE
VLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Template Name AR module
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1] , [2] , [3]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Maltose/maltodextrin-binding periplasmic protein
BTS Info
Inhibitor Research tool Kd: 4.4 nM Polybatics Ltd [1] , [2] , [3]
References
1 MBP-binding DARPins facilitate the crystallization of an MBP fusion protein. Acta Crystallogr F Struct Biol Commun. 2018 Sep 1;74(Pt 9):549-557.
2 Modular protein switches derived from antibody mimetic proteins. Protein Eng Des Sel. 2016 Feb;29(2):77-85.
3 Bioengineering of bacteria to assemble custom-made polyester affinity resins. Appl Environ Microbiol. 2015 Jan;81(1):282-91.