Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003615) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
DARPin anti-MBP off7-M2
|
|||||
| Synonyms |
DARPin off7 M2
|
|||||
| Molecular Weight | 17.1 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | E. coli strains XL1-Blue | |||||
| Highest Status | Research | |||||
| Sequence Length | 159 | |||||
| SBP Sequence |
>DARPin anti-MBP off7-M2
GSDLGRKLLEAARAGQDDEVRILMANGADVNAADNTGTTPLHLAAYSGHLEIVEVLLKHG ADVDASDVFGYTPLHLAAYWGHLEIVEVLLKNGADVNAMDSDGMTPLHLAAKWGYLEIVE VLLKHGADVNAQDRFGRTAFDISIDNGNEDLAEILQKLN |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | DARPin off7 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS027 | [1] | ||||
| Scaffold Name | DARPin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Maltose/maltodextrin-binding periplasmic protein | binder | Tools for purificating of MBP fusion proteins | Kd: 114 nM | ?afrik University | [1] | |