Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000055) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Monobody anti-MBP YSX1
|
|||||
Synonyms |
Monobody YSX1
|
|||||
Molecular Weight | 10.2 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Yeast display; Surface plasmon resonance | |||||
Highest Status | Research | |||||
PDB ID | 3CSB; 6APX | |||||
Sequence Length | 94 | |||||
SBP Sequence |
>Monobody anti-MBP YSX1
GSSVPTNLEVVAATPTSLLISWDAYSSSYYVYYYRITYGETGGNSPVQEFTVPGSKSTAT ISGLKPGVDYTITVYAGHYLYGLLSSPISINYRT |
|||||
3D Structure | ||||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Fibronectin type III domain (FN3) | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS047 | [1] | ||||
Scaffold Name | Monobody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Maltose/maltodextrin-binding periplasmic protein | Binder | Research tool | Kd: 5.7 nM | University of Chicago; National Cancer Institute at Frederick | [1] | |