Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003614) | ||||||
---|---|---|---|---|---|---|
SBP Name |
DARPin anti-MBP off7-M1
|
|||||
Synonyms |
DARPin off7 M1
|
|||||
Molecular Weight | 17.1 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | E. coli strains XL1-Blue | |||||
Highest Status | Research | |||||
Sequence Length | 159 | |||||
SBP Sequence |
>DARPin anti-MBP off7-M1
GSDLGRRLLEAARAGQDDEVRILMANGADVNAADNTGTTPLHLAAYSGHLEIVEVLLKHG ADVDASDVFGYTPLHLAAYWGHLEIVEVLLKNGADVNAMDSDGMTPLHLAAKWGYLEIVE VLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | DARPin off7 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS027 | [1] | ||||
Scaffold Name | DARPin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Alpha-Helices + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Maltose/maltodextrin-binding periplasmic protein | binder | Tools for purificating of MBP fusion proteins | Kd: 65 nM | ?afrik University | [1] | |