Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000984) | ||||||
---|---|---|---|---|---|---|
SBP Name |
VL dAb anti-MBP VL-1
|
|||||
Synonyms |
VL-1
|
|||||
Molecular Weight | 11.6 kDa | |||||
Thermal Denaturation TEMP | 58.1 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli TG1 | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 107 | |||||
SBP Sequence |
>VL dAb anti-MBP VL-1
DIQMTQSPSSLSASVGDRVTITCPASQSITRNLRWYQQKPGKAPKLLIFAASARASGVPS RFSGSGSGTDFTLTISNLQPEDFATYYCDQHYNTPYTFGHGTKVTVL |
|||||
Sequence Description | Cys I and Cys II form a bridge. | |||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | HVLP324 | |||||
Template Sequence Description | Cys I and Cys II form a bridge. | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS064 | [1] | ||||
Scaffold Name | VL dAb | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Maltose/maltodextrin-binding periplasmic protein | Binder | Tools as soluble and highly thermostable binders | Kd: 1300 nM | National Research Council of Canada | [1] | |