Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000984) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
VL dAb anti-MBP VL-1
|
|||||
| Synonyms |
VL-1
|
|||||
| Molecular Weight | 11.6 kDa | |||||
| Thermal Denaturation TEMP | 58.1 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli TG1 | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 107 | |||||
| SBP Sequence |
>VL dAb anti-MBP VL-1
DIQMTQSPSSLSASVGDRVTITCPASQSITRNLRWYQQKPGKAPKLLIFAASARASGVPS RFSGSGSGTDFTLTISNLQPEDFATYYCDQHYNTPYTFGHGTKVTVL |
|||||
| Sequence Description | Cys I and Cys II form a bridge. | |||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | HVLP324 | |||||
| Template Sequence Description | Cys I and Cys II form a bridge. | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS064 | [1] | ||||
| Scaffold Name | VL dAb | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Maltose/maltodextrin-binding periplasmic protein | Binder | Tools as soluble and highly thermostable binders | Kd: 1300 nM | National Research Council of Canada | [1] | |