Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001093) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Nanobody anti-MBP clone 2
|
|||||
| Synonyms |
Sb_MBP#2; L2_G11 (a-MBP#2)
|
|||||
| Molecular Weight | 13.9 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Ribosome display | |||||
| Highest Status | Research | |||||
| PDB ID | 5M14 | |||||
| Sequence Length | 128 | |||||
| SBP Sequence |
>Nanobody anti-MBP clone 2
GPSQVQLVESGGGSVQAGGSLRLSCAASGQIEHIGYLGWFRQAPGKEREGVAALITYTGH TYYADSVKGRFTVSLDNAKNTVYLQMNSLKPEDTALYYCAAAEWGSQSPLTQWFYRYWGQ GTQVTVSA |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Convex scaffold | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS048 | [1] | ||||
| Scaffold Name | Nanobody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Maltose/maltodextrin-binding periplasmic protein | Binder | Tools for the conformational trapping of membrane proteins | Kd: 40.4 nM | University of Zurich | [1] | |