Details of the BTS
General Information of Binding Target of SBP (BTS) (ID: ST00059) | ||||||
---|---|---|---|---|---|---|
BTS Name |
Vascular endothelial growth factor A
|
|||||
Synonyms |
VEGF-A; Vascular permeability factor; VPF
|
|||||
BTS Type |
Protein
|
|||||
Family |
PDGF/VEGF growth factor family
|
|||||
Gene Name |
VEGFA
|
|||||
Organism |
Homo sapiens (Human)
|
|||||
Function |
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity).
|
|||||
UniProt ID | ||||||
UniProt Entry | ||||||
PFam | ||||||
Gene ID | ||||||
Sequence |
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
|||||
Sequence Length |
232
|
|||||
Synthetic Binding Protein (SBP) Targeting This BTS |
---|
SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
---|---|---|---|---|---|---|
Anticalin Angiocal | Phase I | Inhibitor | Kd: 0.025 nM | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | [1], [2], [3] | |
Cyclotide anti-VEGF-A | Research | Inhibitor | N.A. | Cancers [ICD-11: 2D4Z]; Rheumatoid arthritis [ICD-11: FA20.Z] | [4] | |
DARPin Abicipar pegol | Preregistration | Inhibitor | Kd: 0.002 nM | Age related macular degeneration [ICD-11: 9B75.0Z]; Diabetic macular oedema [ICD-11: 9B71.02] | [5], [1], [6] | |
DARPin anti-PDGF-B/VEGF-A MP0260 | Research | Inhibitor | N.A. | Age related macular degeneration [ICD-11: 9B75.0Z] | [7] | |
DARPin anti-VEGF-A clone 1 | Research | Antagonist | Kd: >=0.025 nM | Anti-angiogenic agents for topical and intravitreal applications | [8] | |
DARPin anti-VEGF-A clone 10 | Research | Antagonist | Kd: >=0.025 nM | Anti-angiogenic agents for topical and intravitreal applications | [8] | |
DARPin anti-VEGF-A clone 2 | Research | Antagonist | Kd: >=0.025 nM | Anti-angiogenic agents for topical and intravitreal applications | [8] | |
DARPin anti-VEGF-A clone 3 | Research | Antagonist | Kd: >=0.025 nM | Anti-angiogenic agents for topical and intravitreal applications | [8] | |
DARPin anti-VEGF-A clone 4 | Research | Antagonist | Kd: >=0.025 nM | Anti-angiogenic agents for topical and intravitreal applications | [8] | |
DARPin anti-VEGF-A clone 5 | Research | Antagonist | Kd: >=0.025 nM | Anti-angiogenic agents for topical and intravitreal applications | [8] | |
DARPin anti-VEGF-A clone 6 | Research | Antagonist | Kd: >=0.025 nM | Anti-angiogenic agents for topical and intravitreal applications | [8] | |
DARPin anti-VEGF-A clone 7 | Research | Antagonist | Kd: >=0.025 nM | Anti-angiogenic agents for topical and intravitreal applications | [8] | |
DARPin anti-VEGF-A clone 8 | Research | Antagonist | Kd: >=0.025 nM | Anti-angiogenic agents for topical and intravitreal applications | [8] | |
DARPin anti-VEGF-A clone 9 | Research | Antagonist | Kd: >=0.025 nM | Anti-angiogenic agents for topical and intravitreal applications | [8] | |
DARPin MP0250 | Phase II | Antagonist | Kd: <1 nM | Multiple myeloma [ICD-11: 2A83.Y]; Non-small cell lung cancer [ICD-11: 2C25.Y]; Solid tumour/cancer [ICD-11: 2A00-2F9Z] | [9], [10], [11] | |
Fab anti-VEGF A4.6.1 | Research | Binder | N.A. | Research tool | [12] | |
Fab anti-VEGF Fab A1 | Research | Binder | Kd: 300 nM | Research tool | [13] | |
Fab anti-VEGF Fab B1 | Research | Binder | Kd: 30 nM | Research tool | [13] | |
Fab anti-VEGF Fab C1 | Research | Binder | Kd: 9.7 nM | Research tool | [13] | |
Fab anti-VEGF Fab D1 | Research | Binder | Kd: 7.8 nM | Research tool | [13] | |
Fab anti-VEGF Fab D2 | Research | Binder | Kd: 4.4 nM | Research tool | [13] | |
Fab anti-VEGF hu2.0 | Research | Binder | Kd: 260 nM | Research tool | [12] | |
Fab anti-VEGF hu2.10 | Research | Binder | Kd: 55 nM | Research tool | [12] | |
Fab anti-VEGF YADS1 | Research | Binder | Kd: 1.8 nM | Research tool | [14] | |
Fab anti-VEGF YADS2 | Research | Binder | Kd: 10 nM | Research tool | [14] | |
Fab anti-VEGF YADS3 | Research | Binder | Kd: 2 nM | Research tool | [14] | |
Fab Ranibizumab | Marketed | Inhibitor | N.A. | Choroidal neovascularisation [ICD-11: 9B76]; Degenerative high myopia [ICD-11: 9B76]; Diabetic macular oedema [ICD-11: 9B71.02]; Retinal oedema [ICD-11: 9B78.7]; Age related macular degeneration [ICD-11: 9B75.0Z]; Diabetic retinopathy [ICD-11: 9B71.0]; Retinopathy of prematurity [ICD-11: 9B71.3]; Polypoidal choroidal vasculopathy [ICD-11: 9B75.Y] | [15] | |
Nanobody anti-VEGF | Research | Inhibitor | N.A. | Cancers [ICD-11: 2D4Z] | [16] | |
Nanobody anti-VEGF clone 22 | Research | Binder | Kd: 10 nM | Cancers [ICD-11: 2D4Z] | [17] | |
Nanobody anti-VEGF clone 23 | Research | Inhibitor | Kd: 10 nM | Cancers [ICD-11: 2D4Z] | [17] | |
Nanobody anti-VEGF clone 35 | Research | Inhibitor | Kd: 45 nM | Cancers [ICD-11: 2D4Z] | [17] | |
Nanobody anti-VEGF clone 42 | Research | Inhibitor | Kd: 60 nM | Cancers [ICD-11: 2D4Z] | [17] | |
Repebody anti-VEGF r-C2 | Research | Inhibitor | Kd: 10.6 nM | Age related macular degeneration [ICD-11: 9B75.0Z]; Diabetic retinopathy [ICD-11: 9B71.0Z]; Cancer metastasis [ICD-11: 2E2Z] | [18] | |
Repebody anti-VEGF r-F1 | Research | Inhibitor | Kd: 80.4 nM | Age related macular degeneration [ICD-11: 9B75.0Z]; Diabetic retinopathy [ICD-11: 9B71.0Z]; Cancer metastasis [ICD-11: 2E2Z] | [18] | |
scFv anti-VEGF-A Brolucizumab | Research | Binder | N.A. | Diabetic macular oedema [ICD-11: 9B71.02]; Retinal vein occlusion [ICD-11: 9B74.1]; Diabetic retinopathy [ICD-11: 9B71.0Z] | [19] | |
scFv anti-VEGF/SasA variants | Research | Binder | N.A. | Research tool | [20] | |
References |
---|