Details of the BTS

General Information of Binding Target of SBP (BTS) (ID: ST00059)
BTS Name	Vascular endothelial growth factor A
Synonyms	VEGF-A; Vascular permeability factor; VPF
BTS Type	Protein
Family	PDGF/VEGF growth factor family
Gene Name	VEGFA
Organism	Homo sapiens (Human)
Function	Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity).
UniProt ID	P15692
UniProt Entry	VEGFA_HUMAN
PFam	PF00341 ; PF14554
Gene ID	7422
Sequence	MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Sequence Length	232

Synthetic Binding Protein (SBP) Targeting This BTS

SBP Name	Highest Status	Mechanism	Affinity	Application	Details	Ref
Anticalin Angiocal	Phase I	Inhibitor	Kd: 0.025 nM	Solid tumour/cancer [ICD-11: 2A00-2F9Z]	SBP Info	[1], [2], [3]
Cyclotide anti-VEGF-A	Research	Inhibitor	N.A.	Cancers [ICD-11: 2D4Z]; Rheumatoid arthritis [ICD-11: FA20.Z]	SBP Info	[4]
DARPin Abicipar pegol	Preregistration	Inhibitor	Kd: 0.002 nM	Age related macular degeneration [ICD-11: 9B75.0Z]; Diabetic macular oedema [ICD-11: 9B71.02]	SBP Info	[5], [1], [6]
DARPin anti-PDGF-B/VEGF-A MP0260	Research	Inhibitor	N.A.	Age related macular degeneration [ICD-11: 9B75.0Z]	SBP Info	[7]
DARPin anti-VEGF-A clone 1	Research	Antagonist	Kd: >=0.025 nM	Anti-angiogenic agents for topical and intravitreal applications	SBP Info	[8]
DARPin anti-VEGF-A clone 10	Research	Antagonist	Kd: >=0.025 nM	Anti-angiogenic agents for topical and intravitreal applications	SBP Info	[8]
DARPin anti-VEGF-A clone 2	Research	Antagonist	Kd: >=0.025 nM	Anti-angiogenic agents for topical and intravitreal applications	SBP Info	[8]
DARPin anti-VEGF-A clone 3	Research	Antagonist	Kd: >=0.025 nM	Anti-angiogenic agents for topical and intravitreal applications	SBP Info	[8]
DARPin anti-VEGF-A clone 4	Research	Antagonist	Kd: >=0.025 nM	Anti-angiogenic agents for topical and intravitreal applications	SBP Info	[8]
DARPin anti-VEGF-A clone 5	Research	Antagonist	Kd: >=0.025 nM	Anti-angiogenic agents for topical and intravitreal applications	SBP Info	[8]
DARPin anti-VEGF-A clone 6	Research	Antagonist	Kd: >=0.025 nM	Anti-angiogenic agents for topical and intravitreal applications	SBP Info	[8]
DARPin anti-VEGF-A clone 7	Research	Antagonist	Kd: >=0.025 nM	Anti-angiogenic agents for topical and intravitreal applications	SBP Info	[8]
DARPin anti-VEGF-A clone 8	Research	Antagonist	Kd: >=0.025 nM	Anti-angiogenic agents for topical and intravitreal applications	SBP Info	[8]
DARPin anti-VEGF-A clone 9	Research	Antagonist	Kd: >=0.025 nM	Anti-angiogenic agents for topical and intravitreal applications	SBP Info	[8]
DARPin MP0250	Phase II	Antagonist	Kd: <1 nM	Multiple myeloma [ICD-11: 2A83.Y]; Non-small cell lung cancer [ICD-11: 2C25.Y]; Solid tumour/cancer [ICD-11: 2A00-2F9Z]	SBP Info	[9], [10], [11]
Fab anti-VEGF A4.6.1	Research	Binder	N.A.	Research tool	SBP Info	[12]
Fab anti-VEGF Fab A1	Research	Binder	Kd: 300 nM	Research tool	SBP Info	[13]
Fab anti-VEGF Fab B1	Research	Binder	Kd: 30 nM	Research tool	SBP Info	[13]
Fab anti-VEGF Fab C1	Research	Binder	Kd: 9.7 nM	Research tool	SBP Info	[13]
Fab anti-VEGF Fab D1	Research	Binder	Kd: 7.8 nM	Research tool	SBP Info	[13]
Fab anti-VEGF Fab D2	Research	Binder	Kd: 4.4 nM	Research tool	SBP Info	[13]
Fab anti-VEGF hu2.0	Research	Binder	Kd: 260 nM	Research tool	SBP Info	[12]
Fab anti-VEGF hu2.10	Research	Binder	Kd: 55 nM	Research tool	SBP Info	[12]
Fab anti-VEGF YADS1	Research	Binder	Kd: 1.8 nM	Research tool	SBP Info	[14]
Fab anti-VEGF YADS2	Research	Binder	Kd: 10 nM	Research tool	SBP Info	[14]
Fab anti-VEGF YADS3	Research	Binder	Kd: 2 nM	Research tool	SBP Info	[14]
Fab Ranibizumab	Marketed	Inhibitor	N.A.	Choroidal neovascularisation [ICD-11: 9B76]; Degenerative high myopia [ICD-11: 9B76]; Diabetic macular oedema [ICD-11: 9B71.02]; Retinal oedema [ICD-11: 9B78.7]; Age related macular degeneration [ICD-11: 9B75.0Z]; Diabetic retinopathy [ICD-11: 9B71.0]; Retinopathy of prematurity [ICD-11: 9B71.3]; Polypoidal choroidal vasculopathy [ICD-11: 9B75.Y]	SBP Info	[15]
Nanobody anti-VEGF	Research	Inhibitor	N.A.	Cancers [ICD-11: 2D4Z]	SBP Info	[16]
Nanobody anti-VEGF clone 22	Research	Binder	Kd: 10 nM	Cancers [ICD-11: 2D4Z]	SBP Info	[17]
Nanobody anti-VEGF clone 23	Research	Inhibitor	Kd: 10 nM	Cancers [ICD-11: 2D4Z]	SBP Info	[17]
Nanobody anti-VEGF clone 35	Research	Inhibitor	Kd: 45 nM	Cancers [ICD-11: 2D4Z]	SBP Info	[17]
Nanobody anti-VEGF clone 42	Research	Inhibitor	Kd: 60 nM	Cancers [ICD-11: 2D4Z]	SBP Info	[17]
Repebody anti-VEGF r-C2	Research	Inhibitor	Kd: 10.6 nM	Age related macular degeneration [ICD-11: 9B75.0Z]; Diabetic retinopathy [ICD-11: 9B71.0Z]; Cancer metastasis [ICD-11: 2E2Z]	SBP Info	[18]
Repebody anti-VEGF r-F1	Research	Inhibitor	Kd: 80.4 nM	Age related macular degeneration [ICD-11: 9B75.0Z]; Diabetic retinopathy [ICD-11: 9B71.0Z]; Cancer metastasis [ICD-11: 2E2Z]	SBP Info	[18]
scFv anti-VEGF-A Brolucizumab	Research	Binder	N.A.	Diabetic macular oedema [ICD-11: 9B71.02]; Retinal vein occlusion [ICD-11: 9B74.1]; Diabetic retinopathy [ICD-11: 9B71.0Z]	SBP Info	[19]
scFv anti-VEGF/SasA variants	Research	Binder	N.A.	Research tool	SBP Info	[20]

References

1	In vitro-engineered non-antibody protein therapeutics. Protein Cell. 2018 Jan;9(1):3-14.
2	Recent advances in the development of novel protein scaffolds based therapeutics. Int J Biol Macromol. 2017 Sep;102:630-641.
3	Functional characterization of a VEGF-A-targeting Anticalin, prototype of a novel therapeutic human protein class. Angiogenesis. 2016 Jan;19(1):79-94.
4	Engineering stabilized vascular endothelial growth factor-A antagonists: synthesis, structural characterization, and bioactivity of grafted analogues of cyclotides. J Med Chem. 2008 Dec 25;51(24):7697-704.
5	Double-Masked, Randomized, Phase 2 Evaluation of Abicipar Pegol (an Anti-VEGF DARPin Therapeutic) in Neovascular Age-Related Macular Degeneration. J Ocul Pharmacol Ther. 2018 Dec;34(10):700-709.
6	A Mechanistic and Translational Pharmacokinetic-Pharmacodynamic Model of Abicipar Pegol and Vascular Endothelial Growth Factor Inhibition. J Pharmacol Exp Ther. 2020 May;373(2):184-192.
7	Molecular Partners. Product Development Pipeline. 2021.
8	Highly potent VEGF-A-antagonistic DARPins as anti-angiogenic agents for topical and intravitreal applications. Angiogenesis. 2013 Jan;16(1):101-11.
9	DARPins: Promising Scaffolds for Theranostics. Acta Naturae. Oct-Dec 2019;11(4):42-53.
10	MP0250, a VEGF and HGF neutralizing DARPin ? molecule shows high anti-tumor efficacy in mouse xenograft and patient-derived tumor models. Oncotarget. 2017 Oct 11;8(58):98371-98383.
11	Beyond antibodies: ankyrins and DARPins. From basic research to drug approval. Curr Opin Pharmacol . 2020 Apr;51:93-101.
12	Antibody humanization using monovalent phage display. J Biol Chem. 1997 Apr 18;272(16):10678-84.
13	High-throughput generation of synthetic antibodies from highly functional minimalist phage-displayed libraries. J Mol Biol. 2007 Nov 2;373(4):924-40.
14	Synthetic antibodies from a four-amino-acid code: a dominant role for tyrosine in antigen recognition. Proc Natl Acad Sci U S A. 2004 Aug 24;101(34):12467-72.
15	Five-Year Outcomes of Panretinal Photocoagulation vs Intravitreous Ranibizumab for Proliferative Diabetic Retinopathy: A Randomized Clinical Trial. JAMA Ophthalmol. 2018 Oct 1;136(10):1138-1148.
16	A nanobody-derived mimotope against VEGF inhibits cancer angiogenesis. J Enzyme Inhib Med Chem. 2020 Dec;35(1):1233-1239.
17	Inhibition of angiogenesis in human endothelial cell using VEGF specific nanobody. Mol Immunol. 2015 May;65(1):58-67.
18	Anti-Human VEGF Repebody Effectively Suppresses Choroidal Neovascularization and Vascular Leakage. PLoS One. 2016 Mar 25;11(3):e0152522.
19	Brolucizumab: First Approval. Drugs. 2019 Dec;79(18):1997-2000.
20	Antibody variable domain interface and framework sequence requirements for stability and function by high-throughput experiments. Structure. 2014 Jan 7;22(1):22-34.