Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003370) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
scFv anti-VEGF-A Brolucizumab
|
|||||
| Synonyms |
scFv Brolucizumab
|
|||||
| Molecular Weight | 26.3 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Research | |||||
| Sequence Length | 252 | |||||
| SBP Sequence |
>scFv anti-VEGF-A Brolucizumab
MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVP SRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGG GSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEW VGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLD IWGQGTLVTVSS |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS057 | [1] | ||||
| Scaffold Name | scFv | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Vascular endothelial growth factor A | Binder | Diabetic macular oedema [ICD-11: 9B71.02]; Retinal vein occlusion [ICD-11: 9B74.1]; Diabetic retinopathy [ICD-11: 9B71.0Z] | N.A. | Mairangi Bay | [1] | |