General Information of Synthetic Binding Protein (SBP) (ID: SBP001036)
SBP Name
Nanobody anti-VEGF clone 22
Synonyms
Nb22
Molecular Weight 14.4 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
Sequence Length 130
SBP Sequence
>Nanobody anti-VEGF clone 22
QVQLQESGGGSVQDGGSLRLSCAASGYAYDTYYMGWFRQAPGKEREGVAGITSLVSGVAY
YKYYTDSVKGRFTIFRDDDKNTVDLQMNSLKPEDTAIYYCAASRSGLRARLLRPELYEYW
GQGTQVTVSS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Vascular endothelial growth factor A
BTS Info
Binder Cancers [ICD-11: 2D4Z] Kd: 10 nM Pasteur Institute of Iran [1]
References
1 Inhibition of angiogenesis in human endothelial cell using VEGF specific nanobody. Mol Immunol. 2015 May;65(1):58-67.