General Information of Synthetic Binding Protein (SBP) (ID: SBP003012)
SBP Name
DARPin anti-VEGF-A clone 3
Synonyms
DARPin #3
Molecular Weight 17.2 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli XL1-Blue
Selection Method Ribosome display
Highest Status Research
Sequence Length 159
SBP Sequence
>DARPin anti-VEGF-A clone 3
GSDLGKKLLEAARTGQDDEVRILMANGADVNATDYMGWTPLHLAAKVGHLEIVEVLLKYG
ADVNAEDYNGYTPLHLAAAMGHLEIAEVLLKYGADVNTKDNTGWTPLHLSADLGHLEIVE
VLLKNGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name AR module
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Vascular endothelial growth factor A
BTS Info
Antagonist Anti-angiogenic agents for topical and intravitreal applications Kd: >=0.025 nM Augenklinik Fribourg University [1]
References
1 Highly potent VEGF-A-antagonistic DARPins as anti-angiogenic agents for topical and intravitreal applications. Angiogenesis. 2013 Jan;16(1):101-11.