Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000406) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Repebody anti-VEGF r-C2
|
|||||
| Synonyms |
Repebody r-C2
|
|||||
| Molecular Weight | 30.6 kDa | |||||
| Thermal Denaturation TEMP | 82 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli Origami B (DE3) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 272 | |||||
| SBP Sequence |
>Repebody anti-VEGF r-C2
ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIAYQSDIKSVQGIQ YLPNVRYLILLQNKLHDISALKELTNLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQ LQSLPDGVFDKLTNLTYLNLAHNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPEGVFDKL TQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRN SAGSVAPDSAKCSGSGKPVRSIICPTHHHHHH |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | PDBID 3RFS | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS055 | [1] | ||||
| Scaffold Name | Repebody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Vascular endothelial growth factor A | Inhibitor | Age related macular degeneration [ICD-11: 9B75.0Z]; Diabetic retinopathy [ICD-11: 9B71.0Z]; Cancer metastasis [ICD-11: 2E2Z] | Kd: 10.6 nM | Korea Advanced Institute of Science and Technology (KAIST) | [1] | |