Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003016) | ||||||
---|---|---|---|---|---|---|
SBP Name |
DARPin anti-VEGF-A clone 7
|
|||||
Synonyms |
DARPin #7
|
|||||
Molecular Weight | 17.1 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli XL1-Blue | |||||
Selection Method | Ribosome display | |||||
Highest Status | Research | |||||
Sequence Length | 159 | |||||
SBP Sequence |
>DARPin anti-VEGF-A clone 7
GSDLGKKLLEAARAGQDDEVRILMANGADVNAFDWMGWTPLHLAAHEGHLEIVEVLLKNG ADVNATDVSGYTPLHLAAADGHLEIVEVLLKHGADVNTKDNTGWTPLHLSADLGHLEIVE VLLKNGADINAQDKFGKTAFDISIDNGNEDLAEILQKLN |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | AR module | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS027 | [1] | ||||
Scaffold Name | DARPin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Alpha-Helices + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Vascular endothelial growth factor A | Antagonist | Anti-angiogenic agents for topical and intravitreal applications | Kd: >=0.025 nM | Augenklinik Fribourg University | [1] | |