Details of the BTS
General Information of Binding Target of SBP (BTS) (ID: ST00007) | ||||||
---|---|---|---|---|---|---|
BTS Name |
Ephrin type-A receptor 2
|
|||||
Synonyms |
EC 2.7.10.1; Epithelial cell kinase; Tyrosine-protein kinase receptor ECK
|
|||||
BTS Type |
Protein
|
|||||
Family |
Protein kinase superfamily;
Tyr protein kinase family; Ephrin receptor subfamily |
|||||
Gene Name |
EPHA2
|
|||||
Organism |
Homo sapiens (Human)
|
|||||
Function |
Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Activated by the ligand ephrin-A1/EFNA1 regulates migration, integrin-mediated adhesion, proliferation and differentiation of cells. Regulates cell adhesion and differentiation through DSG1/desmoglein-1 and inhibition of the ERK1/ERK2 (MAPK3/MAPK1, respectively) signaling pathway. May also participate in UV radiation-induced apoptosis and have a ligand-independent stimulatory effect on chemotactic cell migration. During development, may function in distinctive aspects of pattern formation and subsequently in development of several fetal tissues. Involved for instance in angiogenesis, in early hindbrain development and epithelial proliferation and branching morphogenesis during mammary gland development. Engaged by the ligand ephrin-A5/EFNA5 may regulate lens fiber cells shape and interactions and be important for lens transparency development and maintenance. With ephrin-A2/EFNA2 may play a role in bone remodeling through regulation of osteoclastogenesis and osteoblastogenesis.; (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) in hepatocytes and facilitates its cell entry. Mediates HCV entry by promoting the formation of the CD81-CLDN1 receptor complexes that are essential for HCV entry and by enhancing membrane fusion of cells expressing HCV envelope glycoproteins.
|
|||||
UniProt ID | ||||||
UniProt Entry | ||||||
PFam | ||||||
Gene ID | ||||||
Sequence |
MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMN
DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL AFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS PEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDI VYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSN SYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGG VAVGVVLLLVLAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQA VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDF LGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGML RGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIP IRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSG SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAY SLLGLKDQVNTVGIPI |
|||||
Sequence Length |
976
|
|||||
Synthetic Binding Protein (SBP) Targeting This BTS |
---|
SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
---|---|---|---|---|---|---|
Abdurin anti-EphA2/FcRn B11 | Research | Binder | Kd: 4.4 nM | Tumors [ICD-11: XH1N44] | [1] | |
Abdurin anti-EphA2/FcRn B6 | Research | Binder | Kd: 6.5 nM | Tumors [ICD-11: XH1N44] | [1] | |
Abdurin anti-EphA2/FcRn D2 | Research | Binder | Kd: 2.6 nM | Tumors [ICD-11: XH1N44] | [1] | |
Abdurin anti-EphA2/FcRn G7 | Research | Binder | Kd: 8.1 nM | Tumors [ICD-11: XH1N44] | [1] | |
Bicyclic peptide anti-EphA2 clone 6044 | Research | Binder | Kd: 2.8 nM | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | [2] | |
Bicyclic peptide anti-EphA2 clone 6065 | Research | Binder | Kd: 5.8 nM | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | [2] | |
Bicyclic peptide anti-EphA2 clone 6088 | Research | Binder | Kd: 2 nM | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | [2] | |
Bicyclic peptide anti-EphA2 clone 6099 | Research | Binder | Kd: 5.7 nM | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | [2] | |
Bicyclic peptide anti-EphA2/CD137 BT7455 | Research | Binder | N.A. | Cancers [ICD-11: 2D4Z] | [3] | |
Bicyclic peptide BT5528 | Phase II | Inhibitor | N.A. | Non-small cell lung cancer [ICD-11: 2C25.Y]; Breast cancer [ICD-11: 2C6Z]; Bladder cancer [ICD-11: 2C94.Z]; Esophageal cancer [ICD-11: 2B70.Z]; Gastric cancer [ICD-11: 2B72.Z]; Ovarian cancer [ICD-11: 2C73.Z] | [2], [4] | |
Monobody anti-EphA2 E1 | Research | Binder | Kd: 1.8 nM | Imaging agent for patients with EphA2-expressing tumors | [5], [6] | |
Monobody anti-EphA2 E10 | Research | Binder | Kd: 2.1 nM | Cancers [ICD-11: 2D4Z] | [7] | |
References |
---|