Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000676) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Abdurin anti-EphA2/FcRn G7
|
|||||
Synonyms |
Abdurin G7
|
|||||
Molecular Weight | 12.0 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | CIS display | |||||
Highest Status | Research | |||||
Sequence Length | 106 | |||||
SBP Sequence |
>Abdurin anti-EphA2/FcRn G7
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVPHLGVDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | CH2 domain of IgG1 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS002 | [1] | ||||
Scaffold Name | Abdurin | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||