Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000676) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Abdurin anti-EphA2/FcRn G7
|
|||||
| Synonyms |
Abdurin G7
|
|||||
| Molecular Weight | 12.0 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | CIS display | |||||
| Highest Status | Research | |||||
| Sequence Length | 106 | |||||
| SBP Sequence |
>Abdurin anti-EphA2/FcRn G7
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVPHLGVDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | CH2 domain of IgG1 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS002 | [1] | ||||
| Scaffold Name | Abdurin | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||