Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000675)
SBP Name
Abdurin anti-EphA2/FcRn D2
Synonyms
Abdurin D2
Molecular Weight 11.9 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method CIS display
Highest Status Research
Sequence Length 106
SBP Sequence
>Abdurin anti-EphA2/FcRn D2
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVYEAAALPEVKFNWYVDGVEVHNAKTKPRQL
DPLYGYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name CH2 domain of IgG1
Protein Scaffold Information of This SBP
Scaffold ID PS002
Scaffold Info
[1]
Scaffold Name Abdurin
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Fc receptor
BTS Info
Binder Tumors [ICD-11: XH1N44] N.A. Isogenica Ltd; IRBM Science Park [1]
Ephrin type-A receptor 2
BTS Info
Binder Tumors [ICD-11: XH1N44] Kd: 2.6 nM Isogenica Ltd; IRBM Science Park [1]
References
1 High Affinity Binders to EphA2 Isolated from Abdurin Scaffold Libraries; Characterization, Binding and Tumor Targeting. PLoS One. 2015 Aug 27;10(8):e0135278.