Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001235)
SBP Name
Monobody anti-EphA2 E1
Synonyms
Monobody E1
Molecular Weight 9.9 kDa
Thermal Denaturation TEMP 82 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Yeast display
Highest Status Research
Sequence Length 90
SBP Sequence
>Monobody anti-EphA2 E1
VSDVPRDLEVVAATPTSLLISWYYPFSAFYYRITYGETGGNSPVQEFTVPRPSDTATISG
LKPGVDYTITVYAVTSLGSYSRPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1] , [2]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Ephrin type-A receptor 2
BTS Info
Binder Imaging agent for patients with EphA2-expressing tumors Kd: 1.8 nM Chonnam National University Medical School and Hwasun Hospital [1] , [2]
References
1 Production of 64 Cu-labeled monobody for imaging of human EphA2-expressing tumors. Bioorg Med Chem Lett. 2020 Jul 15;30(14):127262.
2 Engineering of monobody conjugates for human EphA2-specific optical imaging. PLoS One . 2017 Jul 7;12(7):e0180786.