General Information of Binding Target of SBP (BTS) (ID: ST00003)
BTS Name
Tumor necrosis factor
Synonyms
Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a
BTS Type
Protein
Family
Tumor necrosis factor family
Gene Name
TNF
Organism
Homo sapiens (Human)
Function
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T-cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Upregulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective Key mediator of cell death in the anticancer action of BCG-stimulated neutrophils in combination with DIABLO/SMAC mimetic in the RT4v6 bladder cancer cell line Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance (By similarity). Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6 ; The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
UniProt ID
P01375
UniProt Entry
TNFA_HUMAN
PFam
PF00229
Gene ID
7124
Sequence
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Sequence Length
233
Synthetic Binding Protein (SBP) Targeting This BTS
SBP Name Highest Status Mechanism Affinity Application Details Ref
ABD-derived affinity protein anti-TNF-alpha/HSA clone 1 Research Binder Kd: 385 nM Research tool
SBP Info
[1]
ABD-derived affinity protein anti-TNF-alpha/HSA clone 2 Research Binder Kd: 1560 nM Research tool
SBP Info
[1]
ABD-derived affinity protein anti-TNF-alpha/HSA HT014 Research Binder Kd: 5.0 nM Research tool
SBP Info
[1]
ABD-derived affinity protein anti-TNF-alpha/HSA HT015 Research Binder Kd: 4.4 nM Research tool
SBP Info
[1]
ABD-derived affinity protein anti-TNF-alpha/HSA HT016 Research Binder Kd: 4.5 nM Research tool
SBP Info
[1]
ABD-derived affinity protein anti-TNF-alpha/HSA T001 Research Binder Kd: 5.2 nM Research tool
SBP Info
[1]
ABD-derived affinity protein anti-TNF-alpha/HSA T002 Research Binder Kd: 2.9 nM Research tool
SBP Info
[1]
ABD-derived affinity protein anti-TNF-alpha/HSA T004 Research Binder Kd: 4 nM Research tool
SBP Info
[1]
Affibody anti-TNF-alpha Z(TNF-alpha)1 Research Binder Kd: 0.095 nM Tools for a novel affinity protein selection system
SBP Info
[2]
Affibody anti-TNF-alpha Z(TNF-alpha)2 Research Binder Kd: 0.3 nM Tools for a novel affinity protein selection system
SBP Info
[2]
Alphabody anti-TNF-alpha/IL-23 CMX-02 Research Binder N.A. Psoriatic arthritis [ICD-11: FA21.Z]; Crohn disease [ICD-11: DD70.Z]
SBP Info
[3]
Bicyclic peptide anti-TNF-alpha anticachexin C1 Research Inhibitor Kd: 450 nM Tools for inhibiting protein-protein interactions
SBP Info
[4]
Bicyclic peptide anti-TNF-alpha M21 Research Inhibitor Kd: 13.5 nM Inflammatory disorders [ICD-11: 4A6Z]
SBP Info
[5]
Defensin A-based binder anti-TNF-alpha Research Binder N.A. Tools as conformation-constrained peptide
SBP Info
[6]
Fab anti-TNF-alpha G10 Research Inhibitor N.A. Research tool
SBP Info
[7]
Fab Certolizumab Marketed Binder N.A. Ankylosing spondylitis [ICD-11: FA96.0Z]; Crohn disease [ICD-11: DD70.Z]; Plaque psoriasis [ICD-11: EA90.0]; Psoriatic arthritis [ICD-11: FA21.Z]; Rheumatoid arthritis [ICD-11: FA20.Z]; Spondylitis [ICD-11: FA92]; Non-radiographic axial spondyloarthritis [ICD-11: FA92.0Y]; Interstitial cystitis [ICD-11: GC00.3]; Juvenile rheumatoid arthritis [ICD-11: FA24.2]
SBP Info
[8]
scFv anti-TNF-alpha G10 Research Binder N.A. Research tool
SBP Info
[7]
scFv anti-TNF-alpha H7 Research Binder N.A. Research tool
SBP Info
[7]
scFv Licaminlimab Phase II Binder N.A. Breast cancer [ICD-11: 2C6Z]
SBP Info
[9]
VNAR anti-TNF-alpha T43 Research Binder N.A. Septic shock [ICD-11: XS26]
SBP Info
[10]
References
1 Engineering bispecificity into a single albumin-binding domain. PLoS One. 2011;6(10):e25791.
2 A novel affinity protein selection system based on staphylococcal cell surface display and flow cytometry. Protein Eng Des Sel. 2008 Apr;21(4):247-55.
3 Complix. Product Development Pipeline. 2021.
4 Screening bicyclic peptide libraries for protein-protein interaction inhibitors: discovery of a tumor necrosis factor- antagonist. J Am Chem Soc. 2013 Aug 14;135(32):11990-5.
5 Subunit disassembly and inhibition of TNF by a semi-synthetic bicyclic peptide. Protein Eng Des Sel. 2015 Feb;28(2):45-52.
6 A conformation-constrained peptide library based on insect defensin A. Peptides. 2004 Apr;25(4):629-35.
7 Optimization and modification of anti-rhTNF- single chain variable fragment antibody: effective in vitro affinity maturation and functional expression of chimeric Fab. Biomed Pharmacother. 2013 Jun;67(5):437-44.
8 [Certolizumab]. Ann Dermatol Venereol. Jun-Jul 2019;146(6-7):487-491.
9 Therapeutic Structural Antibody Database. Emerfetamab
10 Human TNF cytokine neutralization with a vNAR from Heterodontus francisci shark: a potential therapeutic use. MAbs. Jan-Feb 2013;5(1):80-5.