Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000470)
SBP Name
Affibody anti-TNF-alpha Z(TNF-alpha)2
Synonyms
Affibody Z(TNF-alpha)2
Molecular Weight 6.4 kDa
Thermal Denaturation TEMP 53 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display; Staphylococcal surface display; Flow cytometry
Highest Status Research
Sequence Length 58
SBP Sequence
>Affibody anti-TNF-alpha Z(TNF-alpha)2
VDNKFNKERGHAIGEIWELPNLNLAQIVAFIISLHDDPSQSANLLAEAKKLNDAQAPK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Z domain of staphylococcal protein A
Protein Scaffold Information of This SBP
Scaffold ID PS004
Scaffold Info
[1]
Scaffold Name Affibody
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Tumor necrosis factor
BTS Info
Binder Tools for a novel affinity protein selection system Kd: 0.3 nM Royal Institute of Technology [1]
References
1 A novel affinity protein selection system based on staphylococcal cell surface display and flow cytometry. Protein Eng Des Sel. 2008 Apr;21(4):247-55.