Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP003371)
SBP Name
Fab Certolizumab
Synonyms
CDP-870; Certolizumab; PHA-738144; Simziya
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Highest Status Marketed
PDB ID 5WUV
SBP Sequence
>VH Chain
EVQLVESGGGLVQPGGSLRLSCAASGYVFTDYGMNWVRQAPGKGLEWMGWINTYIGEPI
YADSVKGRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCARGYRSYAMDYWGQGTLVTVSS
>VL Chain
DIQMTQSPSSLSASVGDRVTITCKASQNVGTNVAWYQQKPGKAPKALIYSASFLYSGVPY
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYNIYPLTFGQGTKVEIK
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS034
Scaffold Info
[1]
Scaffold Name Fab
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Tumor necrosis factor
BTS Info
Binder Ankylosing spondylitis [ICD-11: FA96.0Z]; Crohn disease [ICD-11: DD70.Z]; Plaque psoriasis [ICD-11: EA90.0]; Psoriatic arthritis [ICD-11: FA21.Z]; Rheumatoid arthritis [ICD-11: FA20.Z]; Spondylitis [ICD-11: FA92]; Non-radiographic axial spondyloarthritis [ICD-11: FA92.0Y]; Interstitial cystitis [ICD-11: GC00.3]; Juvenile rheumatoid arthritis [ICD-11: FA24.2] N.A. Grenoble Alpine University [1]
Clinical Trial Information of This SBP
NCT00152386 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title A Placebo Controlled Study to Assess Efficacy and Safety of Certolizumab Pegol in the Treatment of Rheumatoid Arthritis
Status Completed
Sponsor UCB Pharma
NCT00152425 Click to show the Detail
Indication Crohn Disease
Phase Phase III
Title Study to Test the Effect of CDP870 in the Treatment of Crohn's Disease Over 26 Weeks, Comparing CDP870 to a Dummy Drug (Placebo), Following 3 Doses of Active Drug (CDP870).
Status Completed
Sponsor UCB Pharma
NCT00152490 Click to show the Detail
Indication Crohn Disease
Phase Phase III
Title A Study to Test the Effect of CDP870 in the Treatment of Crohn's Disease Over 26 Weeks, Comparing CDP870 to a Dummy Drug (Placebo)
Status Completed
Sponsor UCB Pharma
NCT00160524 Click to show the Detail
Indication Crohn Disease
Phase Phase III
Title A follow-on Safety Study of CDP870 in Subjects With Crohn's Disease (CD) Who Have Completed a 26-week Double Blind Study CDP870-031 [NCT00152490] or CDP870-032 [NCT00152425]
Status Completed
Sponsor UCB Pharma SA
NCT00160602 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title A Study of Liquid Certolizumab Pegol as Additional Medication to Methotrexate in the Treatment of Signs and Symptoms of Rheumatoid Arthritis and in Prevention of Joint Damage in Patients With Active Rheumatoid Arthritis
Status Completed
Sponsor UCB Pharma
NCT00160641 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title A Study of the Safety and Effectiveness of Liquid Certolizumab Pegol in the Treatment of Signs and Symptoms of Rheumatoid Arthritis and in Prevention of Joint Damage in Patients With Active Rheumatoid Arthritis
Status Completed
Sponsor UCB Pharma
NCT00160693 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title Open Label Long-Term Safety Study of Certolizumab Pegol (CZP) for Patients With Rheumatoid Arthritis
Status Completed
Sponsor UCB Pharma
NCT00160706 Click to show the Detail
Indication Crohn Disease
Phase Phase III
Title A follow-on Safety Study in Subjects With Crohn's Disease Who Have Previously Been Withdrawn From the Double-blind Study CDP870-031 [NCT00152490] or CDP870-032 [NCT00152425] Due to an Exacerbation of Crohn's Disease
Status Completed
Sponsor UCB Pharma SA
NCT00175877 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title A Study of the Safety and Effectiveness of Lyophilized Certolizumab Pegol in the Treatment of Signs and Symptoms of Rheumatoid Arthritis and in Prevention of Joint Damage in Patients With Active Rheumatoid Arthritis
Status Completed
Sponsor UCB Pharma
NCT00245765 Click to show the Detail
Indication Chronic Plaque Psoriasis
Phase Phase II
Title Efficacy Study of CDP870 in Subjects With Chronic Plaque Psoriasis Who Are Candidate for Systemic Therapy and/or Phototherapy/Photochemotherapy
Status Completed
Sponsor UCB Pharma
NCT00291668 Click to show the Detail
Indication Crohn Disease
Phase Phase II
Title Clinical Study of CDP870/Certolizumab Pegol in Patients With Active Crohn's Disease
Status Completed
Sponsor UCB Pharma
NCT00297648 Click to show the Detail
Indication Crohn Disease
Phase Phase III
Title Mucosal Healing Study in Crohn's Disease (CD)
Status Completed
Sponsor UCB Pharma
NCT00307931 Click to show the Detail
Indication Crohn Disease
Phase Phase III
Title Certolizumab Pegol for Treatment of Adult Greek Patients With Moderate to Severe Crohn's Disease Who Failed Infliximab
Status Terminated
Sponsor UCB Pharma
NCT00308581 Click to show the Detail
Indication Crohn Disease
Phase Phase III
Title Certolizumab in Crohn's Disease Patients With Loss of Response or Intolerance to Infliximab
Status Completed
Sponsor UCB Pharma
NCT00329303 Click to show the Detail
Indication Psoriasis
Phase Phase II
Title Efficacy of Re-treatment With Cimzia? in Subject With Chronic Plaque Psoriasis
Status Completed
Sponsor UCB Pharma
NCT00329420 Click to show the Detail
Indication Crohn Disease
Phase Phase II
Title Maintenance Study Including Re-induction Therapy for Patients Who Did Not Show a Clinical Effect in Study C87037 (NCT00291668)
Status Completed
Sponsor UCB Pharma
NCT00329550 Click to show the Detail
Indication Crohn Disease
Phase Phase II
Title Maintenance Study of Certolizumab Pegol (CZP) in Crohn's Disease
Status Completed
Sponsor UCB Japan
NCT00333788 Click to show the Detail
Indication Crohn Disease
Phase Phase III
Title Follow-up to Welcome Study C87042 [NCT00308581] Examining Certolizumab Pegol (CDP870) in Subjects With Crohn's Disease
Status Completed
Sponsor UCB Pharma
NCT00349752 Click to show the Detail
Indication Crohn Disease
Phase Phase III
Title Corticosteroid Sparing Effect of Certolizumab in Crohn's Disease
Status Terminated
Sponsor UCB Pharma
NCT00354367 Click to show the Detail
Indication Crohn Disease
Phase Phase III
Title Evaluate Efficacy of Certolizumab in Crohn's Patients With Draining Fistulas
Status Withdrawn
Sponsor UCB Pharma
NCT00356408 Click to show the Detail
Indication Crohn Disease
Phase Phase III
Title Examining the Long Term Safety, Efficacy, and Corticosteroid-sparing Effect of Certolizumab Pegol in Crohn's Disease
Status Completed
Sponsor UCB Pharma
NCT00358683 Click to show the Detail
Indication Crohn Disease
Phase Phase III
Title A Trial Evaluating Safety of Chronic Therapy With Certolizumab Pegol in Crohn's Disease
Status Withdrawn
Sponsor UCB Pharma
NCT00544154 Click to show the Detail
Indication Arthritis, Rheumatoid
Phase Phase III
Title Efficacy and Safety of CDP870 and Methotrexate Compared to Methotrexate Alone in Subjects With Rheumatoid Arthritis
Status Completed
Sponsor UCB Pharma
NCT00548834 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title Efficacy and Safety of CDP870 Versus Placebo in the Treatment of the Signs and Symptoms of Rheumatoid Arthritis
Status Completed
Sponsor UCB Pharma
NCT00552058 Click to show the Detail
Indication Crohn Disease
Phase Phase III
Title Study to Evaluate Efficacy and Safety of Certolizumab Pegol for Induction of Remission in Patients With Crohn's Disease
Status Completed
Sponsor UCB Pharma
NCT00552344 Click to show the Detail
Indication Crohn Disease
Phase Phase III
Title A Study to Evaluate Safety of Long Term Therapy of Certolizumab Pegol Patients With Crohn's Disease
Status Completed
Sponsor UCB Biosciences
NCT00580840 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase IV
Title Dosing Flexibility Study in Patients With Rheumatoid Arthritis
Status Completed
Sponsor UCB Pharma
NCT00674362 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title Rheumatoid Arthritis (RA) Moderate to Low Disease Activity Study
Status Completed
Sponsor UCB Pharma
NCT00717236 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title Certolizumab Pegol for the Treatment of Patients With Active Rheumatoid Arthritis
Status Completed
Sponsor UCB Pharma
NCT00753454 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title Open Label Extension for Patients Coming From the Dosing Flexibility Study in Patients With Rheumatoid Arthritis (RA)
Status Completed
Sponsor UCB Pharma
NCT00791921 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title Efficacy Confirmation Trial of CDP870 Without Coadministration of Methotrexate (MTX) in Japanese Rheumatoid Arthritis (RA)
Status Completed
Sponsor Otsuka Pharmaceutical
NCT00791999 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase II; Phase III
Title Efficacy Confirmation Trial of CDP870 as add-on Medication to Methotrexate (MTX) in Japanese Rheumatoid Arthritis (RA)
Status Completed
Sponsor Otsuka Pharmaceutical
NCT00813774 Click to show the Detail
Indication Bioavailability Study on Healthy Volunteers
Phase Phase I
Title Bio-availability Comparison of Three Formulations of Certolizumab Pegol in Healthy Volunteers
Status Completed
Sponsor UCB Pharma
NCT00843778 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title Follow-up of Rheumatoid Arthritis (RA) Moderate to Low Disease Activity Study
Status Completed
Sponsor UCB Pharma
NCT00845663 Click to show the Detail
Indication Healthy
Phase Phase I
Title Comparison Bioequivalence Study: Pre-filled Syringe (Reference) Versus Auto-injection Device (Test)
Status Completed
Sponsor UCB Pharma
NCT00850343 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title Long-term Treatment Study of Certolizumab Pegol Without Coadministration of Methotrexate in Japanese Rheumatoid Arthritis (RA) Patients
Status Completed
Sponsor Astellas Pharma Inc
NCT00851318 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title Long-term Treatment Study of Certolizumab Pegol (CDP870) as Add-on Medication to Methotrexate in Japanese Rheumatoid Arthritis (RA) Patients
Status Completed
Sponsor Astellas Pharma Inc
NCT00899678 Click to show the Detail
Indication Crohn Disease
Phase Phase II
Title The Use of Certolizumab Pegol for Treatment of Active Crohn's Disease in Children and Adolescents
Status Terminated
Sponsor UCB Celltech
NCT00993317 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title A Study of CDP870 as Add-on Meditation to Methotrexate (MTX) in Patients With Rheumatoid Arthritis
Status Completed
Sponsor Korea Otsuka Pharmaceutical
NCT00993668 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase IV
Title Assessing the Use of Certolizumab Pegol in Adult Subjects With Rheumatoid Arthritis on the Antibody Response When Receiving Influenza Virus and Pneumococcal Vaccines
Status Completed
Sponsor UCB Pharma
NCT01024647 Click to show the Detail
Indication Crohn Disease
Phase Phase IV
Title Optimizing Cimzia in Crohn's Patients
Status Unknown
Sponsor Atlanta Gastroenterology Associates
NCT01053559 Click to show the Detail
Indication Crohn Disease
Phase Not Applicable
Title Assessment of Small Bowel Healing in Crohn's Disease Patients Treated With Cimzia Using Wireless Capsule Endoscopy
Status Completed
Sponsor Shafran Gastroenterology Center
NCT01069419 Click to show the Detail
Indication Rheumatoid Arthritis
Phase .
Title Observation of Treatment With Certolizumab Pegol in Daily Practice
Status Completed
Sponsor UCB Pharma
NCT01087762 Click to show the Detail
Indication Spondyloarthropathies
Phase Phase III
Title Certolizumab Pegol in Subjects With Active Axial Spondyloarthritis
Status Completed
Sponsor UCB Biosciences
NCT01087788 Click to show the Detail
Indication Arthritis, Psoriatic
Phase Phase III
Title Certolizumab Pegol in Subjects With Adult Onset Active and Progressive Psoriatic Arthritis
Status Completed
Sponsor UCB Biosciences
NCT01090154 Click to show the Detail
Indication Ulcerative Colitis
Phase Phase II
Title Study of Cimzia for the Treatment of Ulcerative Colitis
Status Completed
Sponsor University of Washington
NCT01091220 Click to show the Detail
Indication Sperm Quality
Phase Phase I
Title Evaluation of the Effects of Certolizumab Pegol on Semen Quality in Healthy Male Volunteers
Status Completed
Sponsor UCB Pharma
NCT01095393 Click to show the Detail
Indication Rheumatoid Arthritis
Phase .
Title National Data Bank for Rheumatic Disease Registry Study of Safety in Patients With Rheumatoid Arthritis Treated With Cimzia? or Disease-modifying Antirheumatic Drugs (DMARDs)
Status Completed
Sponsor UCB Pharma
NCT01098201 Click to show the Detail
Indication Rheumatoid Arthritis
Phase .
Title Certolizumab and Lower Extremity Lymph Flow in Rheumatoid Arthritis (RA)
Status Completed
Sponsor University of Rochester
NCT01145365 Click to show the Detail
Indication Crohns Disease; Fistula; Abscess
Phase Not Applicable
Title Study to Look at Benefit of Surgical Drainage Before Beginning Medical Therapy for Crohns Perianal Fistulas
Status Completed
Sponsor Vanderbilt University Medical Center
NCT01190410 Click to show the Detail
Indication Crohn Disease
Phase Phase II
Title Extension Study to Assess Long Term Safety in Children and Adolescents With Crohn's Disease Receiving Certolizumab Pegol
Status Completed
Sponsor UCB Pharma
NCT01197066 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title Open-label, Extension Study of CDP870 in Patients With Rheumatoid Arthritis
Status Completed
Sponsor Korea Otsuka Pharmaceutical
NCT01213017 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title The Effect of Certolizumab Pegol on MRI Synovitis and Bone Edema in Rheumatoid Arthritis Patients
Status Completed
Sponsor Oklahoma Medical Research Foundation
NCT01235598 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title Magnetic Resonance Image Verified Early Response to Certolizumab Pegol in Subjects With Active Rheumatoid Arthritis (RA)
Status Completed
Sponsor UCB Pharma
NCT01255761 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase IV
Title A Comparison of Two Assessment Tools in Predicting Treatment Success of Cimzia in Rheumatoid Arthritis Subjects
Status Completed
Sponsor UCB Pharma
NCT01288287 Click to show the Detail
Indication Arthritis,Rheumatoid
Phase .
Title Long Term Effects of an Early Response to Certolizumab Pegol (CZP, Cimzia?) in Rheumatoid Arthritis (RA) Patients
Status Completed
Sponsor UCB Pharma
NCT01292265 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title A 12 Week Study to Assess Changes in Joint Inflammation Using Ultrasonography in Patients With Rheumatoid Arthritis (RA)
Status Terminated
Sponsor UCB Pharma
NCT01295151 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase IV
Title SWITCH Clinical Trial for Patients With Rheumatoid Arthritis Who Have Failed an Initial TNF-blocking Drug.
Status Completed
Sponsor Julia Brown
NCT01374971 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title Rheumatoid Arthritis Treatment and Biopsy Study Assessing Certolizumab Pegol (Cimzia)
Status Completed
Sponsor Nathan Wei, MD, FACP, FACR:
NCT01443364 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase IV
Title Open Label Study to Assess the Predictability of Early Response to Certolizumab Pegol in Patients With Rheumatoid Arthritis
Status Completed
Sponsor UCB Pharma
NCT01489384 Click to show the Detail
Indication Rheumatoid Arthritis
Phase .
Title Cimzia Treatment in Rheumatoid Arthritis: Randomizing to Stop Versus Continue Disease-modifying Anti-rheumatic Drug(s)
Status Unknown
Sponsor Pope Research Corporation
NCT01490528 Click to show the Detail
Indication Pediatric Inflammatory Bowel Disease
Phase .
Title Durability and Tolerability of Infliximab in Pediatric Inflammatory Bowel Disease Patients: A 10 Year Single Center Experience
Status Unknown
Sponsor Cedars-Sinai Medical Center
NCT01519791 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title A Multi-center, Randomized, Double-blind, Placebo-controlled Study to Evaluate the Efficacy and Safety of Certolizumab Pegol in Combination With Methotrexate in the Treatment of Disease Modifying Antirheumatic Drugs (DMARD)-na?ve Adults With Early Active Rheumatoid Arthritis
Status Completed
Sponsor UCB Pharma SA
NCT01521923 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title A Multi-center, Randomized, Double-blind, Placebo-controlled Study to Evaluate the Efficacy and Safety of Certolizumab Pegol in Combination With Methotrexate in the Treatment of Disease Modifying Antirheumatic Drugs (DMARD)-na?ve Adults With Early Active Rheumatoid Arthritis
Status Completed
Sponsor UCB Pharma
NCT01526434 Click to show the Detail
Indication Rheumatoid Arthritis
Phase .
Title Health-related Quality of Life and Patient-reported Outcomes in Rheumatoid Arthritis Patients Treated With Certolizumab Pegol
Status Completed
Sponsor UCB Pharma SA
NCT01550003 Click to show the Detail
Indication Polyarticular-course Juvenile Idiopathic Arthritis (JIA)
Phase Phase III
Title Pediatric Arthritis Study of Certolizumab Pegol
Status Recruiting
Sponsor UCB BIOSCIENCES GmbH
NCT01577264 Click to show the Detail
Indication Rheumatoid Arthritis; Crohn Disease
Phase .
Title Certolizumab Pegol for the Treatment of Patients With Active Rheumatoid Arthritis (RA) and Crohn's Disease (CD)
Status Terminated
Sponsor UCB Pharma
NCT01582568 Click to show the Detail
Indication Crohns Disease
Phase .
Title EUS Evaluation of Perianal and Peri-rectal Fistulizing Crohn's Disease With CERTOLIZUMAB Treatment
Status Terminated
Sponsor Baylor College of Medicine
NCT01590966 Click to show the Detail
Indication Axial and Peripheral Spondyloarthritis; Rheumatoid Arthritis
Phase Phase III
Title Scintigraphic Detection of the Biodistribution of Tumor Necrosis Factor With a Radiolabeled Anti-TNF in Patients With Active Rheumatoid Arthritis and Active Axial and Peripheral Spondyloarthritis
Status Completed
Sponsor University Hospital, Ghent
NCT01602302 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase IV
Title Ultrasound and Withdrawal of Biological DMARDs in Rheumatoid Arthritis
Status Terminated
Sponsor Medical University of Graz
NCT01691014 Click to show the Detail
Indication Rheumatoid Arthritis (RA)
Phase .
Title Formation of Antibodies and Subsequent Prediction of Clinical Response in Patients With Rheumatoid Arthritis Treated With Four TNF Blocking Agents
Status Terminated
Sponsor Pfizer
NCT01764321 Click to show the Detail
Indication Rheumatoid Arthritis
Phase .
Title Noninterventional Examination of Subcutaneous (sc) Tumor Necrosis Factor (TNF) Inhibitors
Status Completed
Sponsor UCB Pharma SA
NCT01797224 Click to show the Detail
Indication Crohn Disease; Rheumatoid Arthritis; Ankylosing Spondylitis; Psoriatic Arthritis; Psoriasis
Phase .
Title OTIS Autoimmune Diseases in Pregnancy Project
Status Recruiting
Sponsor University of California, San Diego
NCT01848028 Click to show the Detail
Indication Psoriasis; Psoriatic-arthritis
Phase .
Title PsoBest - The German Psoriasis Registry
Status Recruiting
Sponsor Universit?tsklinikum Hamburg-Eppendorf
NCT01860963 Click to show the Detail
Indication Anal Squamous Intraepithelial Lesion (ASIL); HPV DNA
Phase Not Applicable
Title Anal Dysplasia in Patients With Inflammatory Bowel Disease and Healthy Controls
Status Completed
Sponsor Stanford University
NCT01864265 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title Prediction of Response to Certolizumab Pegol Treatment by Functional MRI of the Brain
Status Completed
Sponsor University of Erlangen-Nrnberg Medical School
NCT02019602 Click to show the Detail
Indication Axial Spondyloarthritis (AxSpA); Non-radiographic Evidence-AxSpA; Ankylosing Spondylitis; Crohn Disease; Psoriatic Arthritis; Rheumatoid Arthritis
Phase Phase I
Title A Multicener, Postmarketing Study Evaluating the Transfer of Cimzia From the Mother to the Infant Via the Placenta
Status Completed
Sponsor UCB Biosciences
NCT02054533 Click to show the Detail
Indication Crohn Disease; Ulcerative Colitis
Phase .
Title Study to Determine Risk Factors for Post-operative Infection in Inflammatory Bowel Disease
Status Completed
Sponsor Icahn School of Medicine at Mount Sinai
NCT02073526 Click to show the Detail
Indication Inflammatory Bowel Disease; Crohn Disease; Ulcerative Colitis
Phase .
Title Anti-TNF-alpha Trough Level Measurements in Inflammatory Bowel Disease
Status Completed
Sponsor Oslo University Hospital
NCT02120807 Click to show the Detail
Indication Stage IV Lung Adenocarcinoma
Phase Phase I
Title Certolizumab in Combination With Chemotherapy for Patients With Stage IV Lung Adenocarcinomas
Status Active, not recruiting
Sponsor Memorial Sloan Kettering Cancer Center
NCT02122406 Click to show the Detail
Indication Rheumatoid Arthritis; Depression; Anxiety
Phase .
Title Depression and Anxiety in Rheumatoid Arthritis
Status Completed
Sponsor University of Pavia
NCT02132234 Click to show the Detail
Indication Rheumatoid Arthritis; Psoriatic Arthritis; Ankylosing Spondylitis; Hypertension
Phase Phase IV
Title Effects of Biological Treatment on Blood Pressure and Endothelial Function in Patients With Rheumatoid Arthritis, Psoriatic Arthritis and Ankylosing Spondylitis
Status Unknown
Sponsor Jagiellonian University
NCT02154425 Click to show the Detail
Indication Axial Spondyloarthritis (AxSpA); Non-radiographic Evidence-AxSpA; Ankylosing Spondylitis; Crohn Disease; Psoriatic Arthritis; Rheumatoid Arthritis
Phase Phase I
Title A Multicenter, Postmarketing Study Evaluating the Concentration of Cimzia? in Mature Breast Milk of Lactating Mothers
Status Completed
Sponsor UCB Biosciences
NCT02293590 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase II
Title RICE: Remission by Intra-articular Injection Plus CErtolizumab
Status Completed
Sponsor Rdiger B. Mller
NCT02319642 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase III
Title An Open-label Extension Study of Certolizumab Pegol in Chinese Patients With Rheumatoid Arthritis Who Enrolled in RA0044
Status Completed
Sponsor UCB Pharma SA
NCT02326272 Click to show the Detail
Indication Psoriasis; Plaque Psoriasis
Phase Phase III
Title A Study to Evaluate the Efficacy and Safety of Two Dose Levels of Certolizumab Pegol (CZP) in Subjects With Plaque Psoriasis (PSO)
Status Completed
Sponsor UCB Biopharma
NCT02326298 Click to show the Detail
Indication Psoriasis; Plaque Psoriasis
Phase Phase III
Title An Efficacy and Safety Study of Two Dose Levels of Certolizumab Pegol (CZP) in Subjects With Plaque Psoriasis (PSO)
Status Completed
Sponsor UCB Biopharma
NCT02346240 Click to show the Detail
Indication Psoriasis; Plaque Psoriasis
Phase Phase III
Title Efficacy and Safety Study of Certolizumab Pegol (CZP) Versus Active Comparator and Placebo in Subjects With Plaque Psoriasis (PSO)
Status Completed
Sponsor UCB Biopharma S.P.R.L.
NCT02354105 Click to show the Detail
Indication Axial Spondyloarthritis
Phase .
Title A Study to Assess the Effectiveness of Certolizumab Pegol in Patients With Axial Spondyloarthritis in Daily Life
Status Completed
Sponsor UCB Biopharma S.P.R.L.
NCT02365948 Click to show the Detail
Indication Healthy Subjects
Phase Phase I
Title A Study of Certolizumab Pegol to Evaluate Pharmacokinetics and Safety in Adult Healthy Chinese Subjects
Status Completed
Sponsor UCB Pharma
NCT02430909 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase II
Title Multiple Dose Study of UCB4940 as add-on to Certolizumab Pegol in Subjects With Rheumatoid Arthritis
Status Completed
Sponsor UCB Celltech
NCT02451748 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase IV
Title IL-7 and IL-7R Expression in RA Patients With Active vs. Inactive Disease Treated With DMARD or CIMZIA
Status Completed
Sponsor University of Illinois at Chicago
NCT02505542 Click to show the Detail
Indication Axial Spondyloarthrithis; Ankylosing Spondylitis
Phase Phase III
Title Study to Evaluate Maintenance of Sustained Remission of axSpA With CZP Compared to Placebo
Status Completed
Sponsor UCB Biosciences
NCT02531061 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Not Applicable
Title Impact of the Persistence of Inflammation at Doppler Ultrasound Level on the Structural Evolution of Erosion in Rheumatoid Arthritis Treated With Biotherapy
Status Completed
Sponsor Centre Hospitalier Universitaire de Saint Etienne
NCT02552212 Click to show the Detail
Indication Axial Spondyloarthritis; Nonradiographic Axial Spondyloarthritis; Nr-axSpA
Phase Phase III
Title Multicenter Study Evaluating Certolizumab Pegol Compared to Placebo in Subjects With axSpA Without X-ray Evidence of AS
Status Completed
Sponsor UCB Biosciences
NCT02586246 Click to show the Detail
Indication Active Rheumatoid Arthritis
Phase Phase III
Title Long-term Treatment Study of CDP870 Self-injection in Patients With Active Rheumatoid Arthritis Who Are Participating in the Long-term Treatment Studies (Study 275-08-002 or Study 275-08-004) of CDP870
Status Completed
Sponsor Astellas Pharma Inc
NCT02597829 Click to show the Detail
Indication Crohn Disease
Phase Phase IV
Title Does Clinical Response Correlate With Serum Certolizumab Levels?
Status Unknown
Sponsor Shafran Gastroenterology Center
NCT02714881 Click to show the Detail
Indication Rheumatoid Arthritis; Cardiovascular Disease
Phase Not Applicable
Title Lipids, Inflammation, and CV Risk in RA
Status Active, not recruiting
Sponsor Brigham and Women's Hospital
NCT02755194 Click to show the Detail
Indication Lactation
Phase .
Title "Drugs in Lactation" Analysis Consortium
Status Terminated
Sponsor The Hospital for Sick Children
NCT02775656 Click to show the Detail
Indication Rheumatoid Arthritis (RA); Crohn Disease (CD); Psoriatic Arthritis (PsA); Axial Spondyloarthritis and Ankylosing Spondylitis
Phase .
Title UCB Cimzia Pregnancy Follow-up Study
Status Terminated
Sponsor UCB Biosciences
NCT02806219 Click to show the Detail
Indication Healthy
Phase Phase I
Title Open-label, Bioequivalence Study of Certolizumab Pegol 200 mg Solution Injected Either by a Prefilled Syringe (Reference) or by an E-Device (Test) in Healthy Subjects
Status Completed
Sponsor UCB Biosciences
NCT03016260 Click to show the Detail
Indication RheumatoId Arthritis
Phase .
Title RABIOPRED - a Validation Study of Theranostic Test to PREDict Treatment Response of Anti-TNF BIologicals in Rheumatoid Arthritis
Status Terminated
Sponsor TcLand Expression S.A.
NCT03020992 Click to show the Detail
Indication Axial Spondyloarthritis (axSpA); Anterior Uveitis (AU)
Phase Phase IV
Title A Study to Assess the Effects of Certolizumab Pegol on the Reduction of Anterior Uveitis (AU) Flares in Axial Spondyloarthritis Subjects With a Documented History of AU
Status Completed
Sponsor UCB Biopharma SRL
NCT03051217 Click to show the Detail
Indication Moderate to Severe Psoriasis; Generalized Pustular Psoriasis and Erythrodermic Psoriasis
Phase Phase II; Phase III
Title A Study to Test the Efficacy and Safety of Certolizumab Pegol in Japanese Subjects With Moderate to Severe Chronic Psoriasis
Status Completed
Sponsor UCB Biopharma S.P.R.L.
NCT03100253 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase IV
Title Rheumatoid Arthritis Treatment After First Anti-TNF INvestiGation
Status Recruiting
Sponsor Mario Negri Institute for Pharmacological Research
NCT03152058 Click to show the Detail
Indication High Risk Pregnancy; Pregnancy Complications; Antiphospholipid Syndrome in Pregnancy; Lupus Anticoagulant Disorder
Phase Phase II
Title IMPACT Study: IMProve Pregnancy in APS With Certolizumab Therapy
Status Recruiting
Sponsor Ware Branch
NCT03168347 Click to show the Detail
Indication Psoriasis
Phase Not Applicable
Title Assessing Patient Confidence in Biologic Medications
Status Recruiting
Sponsor Wake Forest University Health Sciences
NCT03215277 Click to show the Detail
Indication Ankylosing Spondylitis
Phase Phase II
Title A Study to Test the Efficacy and Safety of Bimekizumab and Certolizumab Pegol in Patients With Active Ankylosing Spondylitis
Status Completed
Sponsor UCB Biopharma S.P.R.L.
NCT03266471 Click to show the Detail
Indication Inflammatory Bowel Diseases
Phase .
Title Cytokines and Genes in Therapeutic Response in Crohn's Disease
Status Active, not recruiting
Sponsor Vanderbilt University Medical Center
NCT03293784 Click to show the Detail
Indication Melanoma
Phase Phase I
Title TNF-Inhibitor as Immune Checkpoint Inhibitor for Advanced MELanoma
Status Recruiting
Sponsor Institut Claudius Regaud
NCT03445845 Click to show the Detail
Indication Axial Spondyloarthritis
Phase Phase IV
Title Rotation or Change of Biotherapy After TNF Blocker Treatment Failure for Axial Spondyloarthritis
Status Recruiting
Sponsor Centre Hospitalier Universitaire de Saint Etienne
NCT03559660 Click to show the Detail
Indication Crohn Disease
Phase .
Title CUP Certolizumab Pegol (CDP-870) in Adults Suffering From Crohn's Disease (CD)
Status Available
Sponsor UCB Biopharma S.P.R.L.
NCT03559686 Click to show the Detail
Indication Rheumatoid Arthritis
Phase .
Title Named Patient Program With Certolizumab Pegol in Adults Suffering From Rheumatoid Aarthritis (RA)
Status Available
Sponsor UCB Biopharma S.P.R.L.
NCT03591770 Click to show the Detail
Indication Inflammatory Bowel Diseases
Phase Phase IV
Title Shingrix Vaccine in Patients With Moderate to Severe Ulcerative Colitis on Tofacitinib
Status Recruiting
Sponsor Boston Medical Center
NCT03853395 Click to show the Detail
Indication Arthritis, Rheumatoid; Arthritis, Psoriatic
Phase Not Applicable
Title BIOTIPRA: BIOmarker-guided Treatment Decisions In Psoriatic and Rheumatoid Arthritis
Status Recruiting
Sponsor University of Manchester
NCT03955861 Click to show the Detail
Indication Psoriatic Arthritis; Psoriasis; Enthesitis
Phase .
Title Ultrasound Enthesitis Response in Psoriatic Arthritis
Status Unknown
Sponsor Belfast Health and Social Care Trust
NCT04053881 Click to show the Detail
Indication Plaque Psoriasis
Phase .
Title A Study to Assess How Well Certolizumab Pegol Works in Patients With Moderate to Severe Plaque Psoriasis as Part of Routine Clinical Practice
Status Recruiting
Sponsor UCB Biopharma SRL
NCT04123795 Click to show the Detail
Indication Moderate Chronic Plaque Psoriasis; Severe Chronic Plaque Psoriasis; Mixed Guttate/Plaque Psoriasis
Phase Phase III
Title A Study to Evaluate the Efficacy, Safety, and Drug Concentration of Certolizumab Pegol (CZP) in Children and Adolescent Study Participants With Moderate to Severe Chronic Plaque Psoriasis (PSO)
Status Recruiting
Sponsor UCB Biopharma SRL
NCT04163016 Click to show the Detail
Indication Rheumatoid Arthritis; Psoriatic Arthritis; Crohn Disease; Axial Spondyloarthritis; Plaque Psoriasis
Phase Phase I
Title A Study in Pregnant Women With Chronic Inflammatory Diseases Treated With Cimzia (Certolizumab Pegol)
Status Recruiting
Sponsor UCB Biopharma S.P.R.L.
NCT04429776 Click to show the Detail
Indication Rheumatoid Arthritis; Psoriatic Arthritis
Phase Not Applicable
Title Tapering of Biologics in Inflammatory Arthritis Patients in Remission
Status Not Recruiting
Sponsor University of Manchester
NCT04569890 Click to show the Detail
Indication Rheumatoid Arthritis; Pregnancy Related
Phase Not Applicable
Title Treatment of Pregnancy RA
Status Not Recruiting
Sponsor RenJi Hospital
NCT04610476 Click to show the Detail
Indication Psoriatic Arthritis; Withdrawal; Reduction
Phase Phase III
Title Impact of Tapering Immunosuppressants on Maintaining Minimal Disease Activity in Adult Subjects With Psoriatic Arthritis
Status Not Recruiting
Sponsor University of Erlangen-Nrnberg Medical School
NCT04643483 Click to show the Detail
Indication Crohn Disease
Phase Phase III
Title A Study to Test Efficacy, Safety, and Pharmacokinetics of Certolizumab Pegol in Children and Adolescents With Moderately to Severely Active Crohn's Disease
Status Withdrawn
Sponsor UCB Biopharma SRL
NCT04725422 Click to show the Detail
Indication Chronic Nonbacterial Osteomyelitis; Chronic Recurrent Multifocal Osteomyelitis
Phase .
Title CHronic Nonbacterial Osteomyelitis International Registry (CHOIR)
Status Recruiting
Sponsor Seattle Children's Hospital
NCT04740814 Click to show the Detail
Indication Rheumatoid Arthritis
Phase Phase I
Title A Study to Assess the Pharmacokinetics of Certolizumab Pegol in Adults With Active Rheumatoid Arthritis
Status Recruiting
Sponsor UCB Biopharma SRL
NCT04891640 Click to show the Detail
Indication Juvenile Spondyloarthritis
Phase Not Applicable
Title Biologic Abatement and Capturing Kids' Outcomes and Flare Frequency in Juvenile Spondyloarthritis
Status Not Recruiting
Sponsor Children's Hospital of Philadelphia
NCT06028438 Click to show the Detail
Indication Arthritis, Rheumatoid
Phase Phase II
Title A Study to Evaluate the Nipocalimab and Certolizumab Combination Therapy in Participants With Active Rheumatoid Arthritis
Status Recruiting
Sponsor Janssen Research & Development, LLC
References
1 [Certolizumab]. Ann Dermatol Venereol. Jun-Jul 2019;146(6-7):487-491.