Details of the BTS
General Information of Binding Target of SBP (BTS) (ID: ST00003) | ||||||
---|---|---|---|---|---|---|
BTS Name |
Tumor necrosis factor
|
|||||
Synonyms |
Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a
|
|||||
BTS Type |
Protein
|
|||||
Family |
Tumor necrosis factor family
|
|||||
Gene Name |
TNF
|
|||||
Organism |
Homo sapiens (Human)
|
|||||
Function |
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T-cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Upregulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective Key mediator of cell death in the anticancer action of BCG-stimulated neutrophils in combination with DIABLO/SMAC mimetic in the RT4v6 bladder cancer cell line Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance (By similarity). Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6 ; The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
|
|||||
UniProt ID | ||||||
UniProt Entry | ||||||
PFam | ||||||
Gene ID | ||||||
Sequence |
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
|||||
Sequence Length |
233
|
|||||
Synthetic Binding Protein (SBP) Targeting This BTS |
---|
SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
---|---|---|---|---|---|---|
ABD-derived affinity protein anti-TNF-alpha/HSA clone 1 | Research | Binder | Kd: 385 nM | Research tool | [1] | |
ABD-derived affinity protein anti-TNF-alpha/HSA clone 2 | Research | Binder | Kd: 1560 nM | Research tool | [1] | |
ABD-derived affinity protein anti-TNF-alpha/HSA HT014 | Research | Binder | Kd: 5.0 nM | Research tool | [1] | |
ABD-derived affinity protein anti-TNF-alpha/HSA HT015 | Research | Binder | Kd: 4.4 nM | Research tool | [1] | |
ABD-derived affinity protein anti-TNF-alpha/HSA HT016 | Research | Binder | Kd: 4.5 nM | Research tool | [1] | |
ABD-derived affinity protein anti-TNF-alpha/HSA T001 | Research | Binder | Kd: 5.2 nM | Research tool | [1] | |
ABD-derived affinity protein anti-TNF-alpha/HSA T002 | Research | Binder | Kd: 2.9 nM | Research tool | [1] | |
ABD-derived affinity protein anti-TNF-alpha/HSA T004 | Research | Binder | Kd: 4 nM | Research tool | [1] | |
Affibody anti-TNF-alpha Z(TNF-alpha)1 | Research | Binder | Kd: 0.095 nM | Tools for a novel affinity protein selection system | [2] | |
Affibody anti-TNF-alpha Z(TNF-alpha)2 | Research | Binder | Kd: 0.3 nM | Tools for a novel affinity protein selection system | [2] | |
Alphabody anti-TNF-alpha/IL-23 CMX-02 | Research | Binder | N.A. | Psoriatic arthritis [ICD-11: FA21.Z]; Crohn disease [ICD-11: DD70.Z] | [3] | |
Bicyclic peptide anti-TNF-alpha anticachexin C1 | Research | Inhibitor | Kd: 450 nM | Tools for inhibiting protein-protein interactions | [4] | |
Bicyclic peptide anti-TNF-alpha M21 | Research | Inhibitor | Kd: 13.5 nM | Inflammatory disorders [ICD-11: 4A6Z] | [5] | |
Defensin A-based binder anti-TNF-alpha | Research | Binder | N.A. | Tools as conformation-constrained peptide | [6] | |
Fab anti-TNF-alpha G10 | Research | Inhibitor | N.A. | Research tool | [7] | |
Fab Certolizumab | Marketed | Binder | N.A. | Ankylosing spondylitis [ICD-11: FA96.0Z]; Crohn disease [ICD-11: DD70.Z]; Plaque psoriasis [ICD-11: EA90.0]; Psoriatic arthritis [ICD-11: FA21.Z]; Rheumatoid arthritis [ICD-11: FA20.Z]; Spondylitis [ICD-11: FA92]; Non-radiographic axial spondyloarthritis [ICD-11: FA92.0Y]; Interstitial cystitis [ICD-11: GC00.3]; Juvenile rheumatoid arthritis [ICD-11: FA24.2] | [8] | |
scFv anti-TNF-alpha G10 | Research | Binder | N.A. | Research tool | [7] | |
scFv anti-TNF-alpha H7 | Research | Binder | N.A. | Research tool | [7] | |
scFv Licaminlimab | Phase II | Binder | N.A. | Breast cancer [ICD-11: 2C6Z] | [9] | |
VNAR anti-TNF-alpha T43 | Research | Binder | N.A. | Septic shock [ICD-11: XS26] | [10] | |
References |
---|