Details of the BTS

General Information of Binding Target of SBP (BTS) (ID: ST00063)
BTS Name
Cytotoxic T-lymphocyte protein 4
Synonyms
Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD antigen CD152
BTS Type
Protein
Gene Name
CTLA4
Organism
Homo sapiens (Human)
Function
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
UniProt ID
P16410
UniProt Entry
CTLA4_HUMAN
PFam
PF07686
Gene ID
1493
Sequence
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEY
ASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR
AMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFL
LTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Sequence Length
223
Synthetic Binding Protein (SBP) Targeting This BTS
SBP Name Highest Status Mechanism Affinity Application Details Ref
Anticalin anti-CTLA-4 Lcn2m6 Research Blocker Kd: 600 nM Research tool
SBP Info
 		[1]
Anticalin anti-CTLA-4 Lcn2m7.1 Research Blocker Kd: 190 nM Research tool
SBP Info
 		[1]
Anticalin anti-CTLA-4 PRS-010 Research Binder N.A. Cancers [ICD-11: 2D4Z]
SBP Info
 		[2]
Anticalin anti-CTLA-4 PRS-010#001 Research Binder Kd: 79.8 nM Immunotherapy of cancer and infectious disease
SBP Info
 		[3]
Anticalin anti-CTLA-4 PRS-010#002 Research Binder Kd: 23.8 nM Immunotherapy of cancer and infectious disease
SBP Info
 		[3]
Anticalin anti-CTLA-4 PRS-010#003 Research Binder Kd: 9 nM Immunotherapy of cancer and infectious disease
SBP Info
 		[3]
DART MGD-019 Phase I Inhibitor N.A. Solid tumour/cancer [ICD-11: 2A00-2F9Z]
SBP Info
 		[4]
Knottin anti-CTLA-4 MC-CT-010 Research Binder Kd: 3000 nM Cancer metastasis [ICD-11: 2E2Z]
SBP Info
 		[5]
Knottin anti-CTLA-4 MC-CT-020 Research Binder Kd: 17000 nM Cancer metastasis [ICD-11: 2E2Z]
SBP Info
 		[5]
Knottin anti-CTLA-4 MC-CT-030 Research Binder Kd: 7000 nM Cancer metastasis [ICD-11: 2E2Z]
SBP Info
 		[5]
Knottin anti-CTLA-4 MC-CT-040 Research Binder Kd: 20000 nM Cancer metastasis [ICD-11: 2E2Z]
SBP Info
 		[5]
Miniprotein anti-CTLA-4 DBP40_01 Research binder N.A. Research tool
SBP Info
 		[6]
References
1 High-throughput sorting of an Anticalin library via EspP-mediated functional display on the Escherichia coli cell surface. J Mol Biol. 2010 Jul 23;400(4):783-802.
2 Challenges and opportunities for non-antibody scaffold drugs. Drug Discov Today. 2015 Oct;20(10):1271-83.
3 An engineered lipocalin specific for CTLA-4 reveals a combining site with structural and conformational features similar to antibodies. Proc Natl Acad Sci U S A. 2009 May 19;106(20):8198-203.
4 MacroGenics. Product Development Pipeline. 2021.
5 Cystine-knot peptides targeting cancer-relevant human cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). J Pept Sci. 2015 Aug;21(8):651-60.
6 De novo design of protein interactions with learned surface fingerprints