Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003500) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Miniprotein anti-CTLA-4 DBP40_01
|
|||||
| Synonyms |
DBC2_01
|
|||||
| Molecular Weight | 4.7 kDa | |||||
| Design Method | de novo protein design | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Yeast display | |||||
| Highest Status | Research | |||||
| Sequence Length | 40 | |||||
| SBP Sequence |
>DBC2_01
AFITIMDGEEKARKYAKMLKKQNLKVIVLMANGKWIIYAK |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Cytotoxic T-lymphocyte protein 4 | binder | Research tool | N.A. | cole Polytechnique Fdrale de Lausanne | [1] | |