Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00029) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Programmed cell death 1 ligand 1
|
|||||
| Synonyms |
PD-L1; PDCD1 ligand 1; Programmed death ligand 1; hPD-L1; B7 homolog 1; B7-H1; CD antigen CD274
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Immunoglobulin superfamily;
BTN/MOG family |
|||||
| Gene Name |
CD274
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Plays a critical role in induction and maintenance of immune tolerance to self As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cells and limits T-cell effector response Through a yet unknown activating receptor, may costimulate T-cell subsets that predominantly produce interleukin-10 (IL10) ; The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival The interaction with PDCD1/PD-1 inhibits cytotoxic T lymphocytes (CTLs) effector function (By similarity). The blockage of the PDCD1-mediated pathway results in the reversal of the exhausted T-cell phenotype and the normalization of the anti-tumor response, providing a rationale for cancer immunotherapy (By similarity).
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET |
|||||
| Sequence Length |
290
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Affibody anti-PD-L1 Z-j1 | Research | Inhibitor | N.A. | Cancers [ICD-11: 2D4Z] | [1] | |
| Affibody anti-PD-L1 Z-j2 | Research | Inhibitor | N.A. | Cancers [ICD-11: 2D4Z] | [1] | |
| Affibody anti-SARS-CoV-2 M1 | Research | binder | Kd: 68 nM | Tools for PD-L1 imaging and therapy | [2] | |
| Affimer anti-PD-L1 AVA-004 | Research | Inhibitor | N.A. | Tumors [ICD-11: XH1N44] | [3] | |
| Affimer anti-PD-L1/LAG-3 AVA-021 | Research | Inhibitor | N.A. | Tumors [ICD-11: XH1N44] | [3] | |
| Miniprotein anti-PD-L1 DBL1_03 | Research | binder | Kd: 374 nM | Research tool | [4] | |
| Miniprotein anti-PD-L1 DBL1_04 | Research | binder | Kd: 120 nM | Research tool | [4] | |
| Miniprotein anti-PD-L1 DBL2_02 | Research | binder | Kd: 65 nM | Research tool | [4] | |
| Miniprotein anti-PD-L1 DBR3_02 | Research | binder | Kd: 2000 nM | Research tool | [4] | |
| Miniprotein anti-PD-L1 DBR3_03 | Research | binder | Kd: 256 nM | Research tool | [4] | |
| Monobody BMS-986192 | Research | Binder | N.A. | Molecular imaging of PD-L1 expression | [5], [6] | |
| References |
|---|