Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003492) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Miniprotein anti-PD-L1 DBR3_02
|
|||||
| Synonyms |
DBL1_03
|
|||||
| Molecular Weight | 13.7 kDa | |||||
| Design Method | de novo protein design | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Yeast display | |||||
| Highest Status | Research | |||||
| PDB ID | 7XYQ | |||||
| Sequence Length | 119 | |||||
| SBP Sequence |
>DBL1_03
SSIESMKWSMIVQQILCQLETGIDQQKANDVIEGNIDVEDKKVQLYCECILKQFHILDKN NVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPHLKASKLMQCISKYKTWKSFDFL |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Apis mellifera OBP 14 | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Programmed cell death 1 ligand 1 | binder | Research tool | Kd: 2000 nM | cole Polytechnique Fdrale de Lausanne | [1] | |