General Information of Synthetic Binding Protein (SBP) (ID: SBP000467)
SBP Name
Affibody anti-PD-L1 Z-j1
Synonyms
Affibody Z-j1
Molecular Weight 6.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Highest Status Research
Sequence Length 58
SBP Sequence
>Affibody anti-PD-L1 Z-j1
VDNKFNKERRKASIEIRVLPNLNREQGGAFIVSLWDDPSQSANLLAEAKKLNDAQAPK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Z domain of staphylococcal protein A
Protein Scaffold Information of This SBP
Scaffold ID PS004
Scaffold Info
[1]
Scaffold Name Affibody
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Programmed cell death 1 ligand 1
BTS Info
Inhibitor Cancers [ICD-11: 2D4Z] N.A. Tianjin University of Science and Technology; Key Lab of Industrial Fermentation Microbiology of the Ministry of Education [1]
References
1 Screening and production of an affibody inhibiting the interaction of the PD-1/PD-L1 immune checkpoint. Protein Expr Purif. 2020 Feb;166:105520.