Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003566) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Affibody anti-SARS-CoV-2 M1
|
|||||
| Synonyms |
Affibody M1
|
|||||
| Molecular Weight | 6.6 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 | |||||
| Selection Method | mRNA Display | |||||
| Highest Status | Research | |||||
| Sequence Length | 59 | |||||
| SBP Sequence |
>Affibody anti-SARS-CoV-2 M1
MAEAKYAKEHMMAASEILQLPNLTFIQKFVFISKLSDDPSQSSELLSEAKKLNDSQAPK |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS004 | [1] | ||||
| Scaffold Name | Affibody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Three Alpha-Helices | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Programmed cell death 1 ligand 1 | binder | Tools for PD-L1 imaging and therapy | Kd: 9.5 nM | MD Anderson Cancer Center | [1] | |
| Programmed cell death 1 ligand 1 | binder | Tools for PD-L1 imaging and therapy | Kd: 68 nM | MD Anderson Cancer Center | [1] | |